PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_202090_xprd.t2
Common NameSOVF_202090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 348aa    MW: 38434.9 Da    PI: 7.8112
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_202090_xprd.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.13.5e-40100176278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        C v+gC++dl++++eyhrrhkvCe+hsk+pvv+v g+eqrfCqqCsrfh+l+efDe krsCr+rL++hn+rrrk+q+
  Sp_202090_xprd.t2 100 CSVDGCASDLNQCREYHRRHKVCEKHSKTPVVTVGGKEQRFCQQCSRFHSLEEFDEVKRSCRKRLDGHNRRRRKRQP 176
                        **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-3292161IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.37697174IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-3798179IPR004333Transcription factor, SBP-box
PfamPF031105.5E-30100173IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MEWDSKSCAW NGVSKLEIQD NSYHHHLATL AGSSGSGIGN MFSVDLKLGT LGDIGDVSMQ  60
NFKNSMPLSM MDSSSSPSPV LALSKRGRPR NSGAQNTVFC SVDGCASDLN QCREYHRRHK  120
VCEKHSKTPV VTVGGKEQRF CQQCSRFHSL EEFDEVKRSC RKRLDGHNRR RRKRQPEICY  180
MPDSAGGFLS SHTDGMLQFC CPETHTVNWP IMSQQPDMYS QNNNQETMYQ PLVNGVTLTG  240
TSRRGGLKVS PDNLGCALSL LSRYSSDICV EPGMQPTTMS SSTGQGSSST SLHLNNSFLQ  300
LPCSQGLEDM DSSASFSSTT NTNPRSFGGF HDGFRETGSS RIFPFTWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-2991173284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021849559.10.0squamosa promoter-binding-like protein 18 isoform X2
TrEMBLA0A0K9QCD70.0A0A0K9QCD7_SPIOL; Uncharacterized protein
STRINGXP_010679997.11e-173(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-41SBP family protein