PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_192040_qkqw.t1
Common NameSOVF_192040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 989aa    MW: 109671 Da    PI: 7.5829
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_192040_qkqw.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.8e-41146221176
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                        +CqvegC+adls+ak+yhrrhkvCevhska+++lv ++ qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+
  Sp_192040_qkqw.t1 146 ACQVEGCSADLSTAKDYHRRHKVCEVHSKATEALVGNVVQRFCQQCSRFHSLQEFDEGKRSCRRRLAGHNKRRRKT 221
                        5*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-34140208IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.616144221IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-37145223IPR004333Transcription factor, SBP-box
PfamPF031104.3E-30147220IPR004333Transcription factor, SBP-box
SMARTSM00248110758787IPR002110Ankyrin repeat
SuperFamilySSF484034.84E-10759876IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.209.2E-9760874IPR020683Ankyrin repeat-containing domain
CDDcd002041.25E-10763874No hitNo description
PROSITE profilePS500888.683815838IPR002110Ankyrin repeat
SMARTSM002481.4815845IPR002110Ankyrin repeat
PROSITE profilePS502978.587815838IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
MEAEIGGKAN IFGVVVADQK TVGKRTLEWD LNDWKWDGDL FTASPLNSTP LDCRSKQLFP  60
LGPELVANTN VCSKEINKTN EKGKREMEKR RRGVVVPEEE LNDEARPLNL KLGEQVYPIA  120
EGEADKLEGK TVKKSKPTGT GSSQPACQVE GCSADLSTAK DYHRRHKVCE VHSKATEALV  180
GNVVQRFCQQ CSRFHSLQEF DEGKRSCRRR LAGHNKRRRK TLSETSPNVG SLADEKSAGY  240
LLVSLLRILS NSHTHASDES KNQDLIYHLV RNLASQVSGS NMPELQQGSQ SLLNGGISVG  300
IPQKNPSSMQ EPCLAVPSAA AHIGLLTREN RHVTEHTQYA SLPGILHQAG GSVPSKGNEP  360
EAYLKRHGLS GIDLNNVYDD SQERIDIPEK GHGPVACAFR PERLQKSSPP QTSRNSDSTS  420
GHSSSSGSEI QGRTDRIVFK LFGKDPNDLP HQLRTQILDW LSHSPTDIEG YIRPGCIVLT  480
IYLRLNKSSW EELCYDMSSS LSRLLSLSDH PFWKTGWIYT RVQQRAAFIC DGRVVLDTPL  540
PFKSRRSRIS SISPIAVPAD ETVQIVVKGC NLSGPTSRLL CAIEGKYLVQ ESCYSLEGIS  600
TNTAAEQDEI QSLSFHCSIP NVVGRGFIEV EDYGLSGCFF PIIVAEPEIC SEICMLESVM  660
EAVGTDEDIN RKCGTTDGRN DALDFIHEMG WLLHRNHLSI KAGQTDLPLD LFPFVRLKRL  720
IEFSMDHDWC AVLRKLLDLM FSGTVDTGNH ASVEHALSEM PLLHTAVQRN SRPMVDFLLR  780
YMPNKVKGTI GFEQKQSDYG TPSTYLFRPD VTGSNGLTPL HIAASCAGFE NMLDALLEDP  840
GMIGIGAWEN ARDSTGLTPK DYARLRGHNH YMDLFQRKLN KTSSGKHVVV DIVGLTNIES  900
KQKQSDKVKS AKLNSLYTEM WQVRQKCKLC EQKPNYGSRG TSLAFRPAVM SLVAIAVVCV  960
CTALFFKSMP QVCCVFGPFR WEALKYGAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-311472201184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021836165.10.0squamosa promoter-binding-like protein 1
RefseqXP_021836166.10.0squamosa promoter-binding-like protein 1
RefseqXP_021836167.10.0squamosa promoter-binding-like protein 1
TrEMBLA0A0K9QFD70.0A0A0K9QFD7_SPIOL; Uncharacterized protein
STRINGXP_010672614.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12