PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_184590_qemt.t2
Common NameSOVF_184590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 385aa    MW: 43410.9 Da    PI: 8.1245
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_184590_qemt.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52141402128
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPtdeelv +yLk+k+ +++l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t +g+Wkatg+d++++
  Sp_184590_qemt.t2  14 LPGFRFHPTDEELVGFYLKRKILQQSLPI-ELIKQVDIYKYDPWDLPKLASNGEKEWYFYCPRDRKYRNSSRPNRVTCAGFWKATGTDRPIY 104
                        69***************************.89***************88888999************************************* PP

                NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        s+ + + +glkk+Lvfy+gra kg ktdW+mhe+rl
  Sp_184590_qemt.t2 105 SSdSAKCIGLKKSLVFYRGRAAKGMKTDWMMHEFRL 140
                        *955566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.5613171IPR003441NAC domain
SuperFamilySSF1019414.45E-5713171IPR003441NAC domain
PfamPF023652.1E-2515140IPR003441NAC domain
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEKNEVDKVD DVILPGFRFH PTDEELVGFY LKRKILQQSL PIELIKQVDI YKYDPWDLPK  60
LASNGEKEWY FYCPRDRKYR NSSRPNRVTC AGFWKATGTD RPIYSSDSAK CIGLKKSLVF  120
YRGRAAKGMK TDWMMHEFRL PSLSDAAPTK KLFDRSFPAN DSWAICRIFK KTNTMAQRAL  180
SHSWVSALPE TTAACDMFNQ APNFIGSQFS PDNISCTTEA ANSSIQVCNN NDLQNTTSPV  240
SFSTLDQYKP ITNPTVSKVS TIPTSFTDLQ NNLIFPTSEV SAMLLNLTPA FTSDVVKITD  300
TIDFGGSQSQ QLYNGFPMSL SQNIIEADEH LGFRKSQNQQ WNNIRSLGFP FSFPSSVSNS  360
ATLSWDSAPC PSELSTSYSS NKCYR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-531517317170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021861943.10.0protein FEZ-like
TrEMBLA0A0K9QFN00.0A0A0K9QFN0_SPIOL; Uncharacterized protein
STRINGXP_010693234.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-105NAC domain containing protein 94