PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_183860_ymnn.t1
Common NameSOVF_183860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 453aa    MW: 49581.1 Da    PI: 8.3358
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_183860_ymnn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.62.4e-40173250178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +CqvegC+ dls+ak+yhr+h+vCe hsk+p+v+++gle+rfCqqCsrfh +sefD++krsCrrrL++hn+rrrk+++
  Sp_183860_ymnn.t1 173 RCQVEGCNLDLSSAKDYHRKHRVCESHSKCPKVVINGLERRFCQQCSRFHGMSEFDQKKRSCRRRLSDHNARRRKPKP 250
                        6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.5E-33168235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.744171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-38172254IPR004333Transcription factor, SBP-box
PfamPF031101.4E-30174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MSAISMMELN AKSPFLWDWE NLVMFNTKAT ETPKKLQLVE SEIEGIEGFE VGSFYSSGGR  60
SDGGTGSDLG YASSSKSASV DSSTDREIKG NQFSQQDLRS KRDLVNNSGT TIESSVASGE  120
SLIALELGKR TYFEDVSGVS NARNNNTART SCIPPDSVAK KSKSSSLGTE SPRCQVEGCN  180
LDLSSAKDYH RKHRVCESHS KCPKVVINGL ERRFCQQCSR FHGMSEFDQK KRSCRRRLSD  240
HNARRRKPKP EVIQFNSMRL TSSLYEGRNQ LNFAFDQVPM LQSRHDTWNS GSESKVVTLA  300
KPGFFTTIKS GGTDTTDELL HSTHNNGLQT LETKISPHLF PSKGDVFHRG VAVSVPPVSN  360
NLGAAQDFRA LSLLSTSSWG SSCNPEPSAL NHHPMHTNHT ASLGSPSMPL PLGGPSISSS  420
EFWQAADQPT ASASHGSTFQ LFKAPNDSSF YLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-261742471184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1229246KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021845885.10.0squamosa promoter-binding-like protein 2
RefseqXP_021845887.10.0squamosa promoter-binding-like protein 2
RefseqXP_021845888.10.0squamosa promoter-binding-like protein 2
TrEMBLA0A0K9QHU30.0A0A0K9QHU3_SPIOL; Uncharacterized protein
STRINGXP_010682751.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.36e-68squamosa promoter binding protein-like 2