PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_183550_aazg.t1
Common NameSOVF_183550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 268aa    MW: 29957.2 Da    PI: 7.2481
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_183550_aazg.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP77.81.7e-2447982778
                       HHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP 27 hskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                        sk+pvv+v+g+eqrfCqqCsrf +l+efDe krs r+rL++hn+rrrk+q+
  Sp_183550_aazg.t1 47 SSKTPVVIVAGKEQRFCQQCSRFQSLEEFDEVKRSYRKRLDGHNRRRRKRQP 98
                       69***********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114117.426596IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.1E-144783IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-2147102IPR004333Transcription factor, SBP-box
PfamPF031105.8E-174895IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MEWDSESCGW NGVSKLEIED NISYHHHLSP LAAGNTTAAI RYARGTSSKT PVVIVAGKEQ  60
RFCQQCSRFQ SLEEFDEVKR SYRKRLDGHN RRRRKRQPEA FYMPNCAAGF LSSHTADGMV  120
QFCCPQSHTV NWPTMSQPPD LYLRNNQETI YEPLLNGVGQ IGNRTVKVSA DNSGFSLSLL  180
SRYSSDICVE SAMQPTTMSS STGQGQGQGS CTSLHLNNSI VQFSCSHGLE DMETSASLSS  240
RTHNITLQSG HDEFRDPRSS RIFPFGWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-1348953784squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021852908.11e-120uncharacterized protein LOC110792413 isoform X1
TrEMBLA0A0K9QHK90.0A0A0K9QHK9_SPIOL; Uncharacterized protein
STRINGXP_010679997.19e-85(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-23SBP family protein