PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_175670_ohyt.t1
Common NameSOVF_175670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Dof
Protein Properties Length: 110aa    MW: 12265.9 Da    PI: 8.4941
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_175670_ohyt.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.27.4e-331471460
             zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                       ++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvP+G+grrk k 
  Sp_175670_ohyt.t1  1 METKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPIGAGRRKAKP 47
                       69******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-21146IPR003851Zinc finger, Dof-type
PROSITE profilePS5088423.924147IPR003851Zinc finger, Dof-type
PfamPF027012.4E-26146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
METKFCYFNN YNVNQPRHFC KGCQRYWTAG GALRNVPIGA GRRKAKPLGR SGGLFGEGCL  60
LDGMNMEQFD MDGMVVDDWQ LAAAMATGGA FTHDEFQVKR RRSESTGQTC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686204.12e-56PREDICTED: dof zinc finger protein DOF1.5
SwissprotP683503e-44DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A0K9QID83e-79A0A0K9QID8_SPIOL; Uncharacterized protein
STRINGVIT_10s0003g01260.t012e-42(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.12e-45Dof family protein