PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_174320_omwa.t1
Common NameSOVF_174320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 520aa    MW: 57241.3 Da    PI: 6.4043
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_174320_omwa.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.28.6e-42173248277
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                        Cqv gC++dls+ak yhr+hkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Sp_174320_omwa.t1 173 CQVYGCHKDLSSAKAYHRKHKVCDVHSKTSKVIVNGIEQRFCQQCSRFHLLGEFDDGKRSCRKRLAGHNERRRKPQ 248
                        **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-33167234IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.043170247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-38171250IPR004333Transcription factor, SBP-box
PfamPF031107.6E-31173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MESWCFDSLN KGFVSDETIS PSDSIIRNKS VLMGWEFKPS FSYEDSMLVS SQQSVENGCF  60
PEVGIAEMIR KQCPHDSTRN VLEDNGSIGD LYSPSLVTSN VISGNDESSS KFSSSVMDSS  120
SRESSLIDLK LGGFGDIPNS NSIRTAHVLS SAESSTLPKR ARVTSLSSQA AYCQVYGCHK  180
DLSSAKAYHR KHKVCDVHSK TSKVIVNGIE QRFCQQCSRF HLLGEFDDGK RSCRKRLAGH  240
NERRRKPQVG FSGRSGRSYQ SYTGSNFQGF TPTSTSFICQ DILPRGTSQS DTYGTNDWVK  300
HIKVEDGTGY AQKQFPFIDN TNNSESQIAA GENVSQYTHE LVSRSLYQRN SPRSEDLELL  360
DAASTIQGLP GISETGCALS LLSSQSRNSS GQSSTMPGDH PLIIPSSSSH YSVSEVSEKI  420
FGDGTQALTY GDQNSMISIN SMGRYQPSSM LALTNGEAAH FGNEIHHNSN YMNLKDHLLC  480
EDGTTIDLFQ LSSQLQRVEN QKLSEPLKQE TEGFCSLRMT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-30164246284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021838067.10.0squamosa promoter-binding-like protein 13A
RefseqXP_021838068.10.0squamosa promoter-binding-like protein 13A
TrEMBLA0A0K9QIV60.0A0A0K9QIV6_SPIOL; Uncharacterized protein
STRINGXP_010667630.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-48SBP family protein