PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_172970_xkcf.t1
Common NameSOVF_172970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 95aa    MW: 10969.3 Da    PI: 7.4328
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_172970_xkcf.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.61.5e-222470248
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
                       Cq+++C++dl++ak+yhrrhkvCe+h+kapvv+v+ ++qrfCqqCs+
  Sp_172970_xkcf.t1 24 CQADNCTSDLTDAKRYHRRHKVCEFHAKAPVVIVNSKHQRFCQQCSK 70
                       **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114116.462195IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-212271IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.3E-212270IPR004333Transcription factor, SBP-box
PfamPF031102.1E-162470IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MEGFNNSEDE QFMGNSLSYI DVYCQADNCT SDLTDAKRYH RRHKVCEFHA KAPVVIVNSK  60
HQRFCQQCSK CVSHIPPCSH PETYTLTSTS RYLYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-161470157squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021835590.13e-47squamosa promoter-binding protein 1-like
TrEMBLA0A0K9QJ279e-66A0A0K9QJ27_SPIOL; Uncharacterized protein
STRINGcassava4.1_018710m1e-22(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-19squamosa promoter binding protein-like 3