PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_169940_rdod.t1
Common NameSOVF_169940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Dof
Protein Properties Length: 470aa    MW: 51758.4 Da    PI: 8.161
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_169940_rdod.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.71.1e-37183241260
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        +ek+l+c+rC s++tkfCy+nny++sqPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+
  Sp_169940_rdod.t1 183 PEKILPCARCSSMDTKFCYFNNYNISQPRHFCKKCQRYWTAGGSMRNVPVGAGRRKSKN 241
                        78999***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28177240IPR003851Zinc finger, Dof-type
PfamPF027011.9E-30185241IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.577187241IPR003851Zinc finger, Dof-type
PROSITE patternPS013610189225IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MKCIAPLWES GGRNIPLVPL ENSTNYSYPT PTKGTRTTLL GTWAGTLQWV NKRRGTGKCK  60
RFSPQRALIR IALKDVSDDF DYDCESTCSA EDVLCSKQDR NRGNEESITK ETVVNKQEEE  120
PSSNSGLEEP KTPTTPSTNT ENPKTRANNK VCSSQDLSKK DQDQSDQASS NSESQDETLL  180
KKPEKILPCA RCSSMDTKFC YFNNYNISQP RHFCKKCQRY WTAGGSMRNV PVGAGRRKSK  240
NYAASQNHHL VIPGASNGLI HHVMGPDGAL VAFGMDSTHS NASQNFHTNG FFRSENETRS  300
SISNGGGTES VQPVPCFPYI SWQPGFPVSF YSTTSPQWGE NVAAAPYNLQ WLPTPSLNSD  360
QSSTTSSPNN STTLGKHSRS SKELEFENSR VVMPKTLRID DPLDASKSSI WTTLGIKNNN  420
HNVSSSIGRI AFLGESQQAK DMPDIEASSM VLQANPAAFS RSLAFHEIAQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683163.11e-140PREDICTED: cyclic dof factor 1-like
TrEMBLA0A0K9QK890.0A0A0K9QK89_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.11e-58cycling DOF factor 1