PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_145940_pawj.t1
Common NameSOVF_145940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family HB-PHD
Protein Properties Length: 827aa    MW: 89982.4 Da    PI: 4.5567
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_145940_pawj.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox41.81.9e-13676719952
                        HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
           Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                        +  +++L e F++n+yp+++++e+LA++lgLt  +V  WF N R
  Sp_145940_pawj.t1 676 EAVTQRLYESFKENQYPDRQTKEKLANELGLTAHRVDKWFGNAR 719
                        567899************************************99 PP

2PHD41.72.7e-14337392151
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +C+ Cg+   +++++++lCdg C++ fH++Cl+++l +e++p g   wlC++C++k
  Sp_145940_pawj.t1 337 FCAKCGAkdLTTGNDIILCDGiCERGFHQYCLNPPLLTEQIPPGdeGWLCPSCDCK 392
                        6999*9977777********88********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579038.23E-15327395IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.9E-13334392IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.78335392IPR019787Zinc finger, PHD-finger
SMARTSM002492.2E-10337390IPR001965Zinc finger, PHD-type
PfamPF006289.5E-12337392IPR019787Zinc finger, PHD-finger
CDDcd155042.86E-26337389No hitNo description
PROSITE patternPS013590338389IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.608.3E-15657719IPR009057Homeodomain-like
SuperFamilySSF466899.41E-13663725IPR009057Homeodomain-like
PROSITE profilePS5007113.232665725IPR001356Homeobox domain
CDDcd000869.98E-12666719No hitNo description
SMARTSM003891.3E-11667729IPR001356Homeobox domain
PfamPF000465.0E-11676719IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    Send to blast
MGNKNDTNAK EKQGVELSEN DLGSLNQLDK PVQMDNVVSD GIFSKGVDVS LGVEHELENQ  60
GGGAHESVKI EQSGFKGKAD SEAEPDNVKV EQNAESKETA IGSSPMEGVQ ISLVEQVENL  120
NGDMLKNSGK IEKNEGDACN TEVVPIAQPT PPPDKTGEKG LVVVFAVPAP DGSEPPKRGR  180
TPKAAVTSMK KTPQLVSGAS NRVLRTKSEE NSEDPEPSVN LETTKGSTGR RGRKKGKEKD  240
GKIDDEFLKM RKHLRYLLHR IHYEQNLLDA YSSEGWRGQS IEKLRPEKEL QRAKADINRS  300
KLKIRDLFQR LHSMSAEGKF PETLYDSEGL IDSEDIFCAK CGAKDLTTGN DIILCDGICE  360
RGFHQYCLNP PLLTEQIPPG DEGWLCPSCD CKHDCVDLLN DSQGTRLAIE DSWEKVFPEA  420
VAATSGKELD DVMGLPSDDS EDNEYNPDGT DDDANVEGNE SSSSESDSDK SDPSDASYVS  480
EDLGATPGTD QNLGLPSDDS EDDDFDPDAA NVNEEGDELE KSSSDFTSAS ENLAEAIGDD  540
GTSDIDVPRL PSEPEQDFGD SPAITSKRCL KRLDYKKLYD ETYENADLDA SDDDDEEWTD  600
MVGTRKRKGT AEKTVSVSTS LGASASADSD CSSGAPRRRS RPKANPRVAN GTPARLQKKG  660
SGGSSKRRPP YNRLGEAVTQ RLYESFKENQ YPDRQTKEKL ANELGLTAHR VDKWFGNARW  720
SFNHRPSRAE ASMSRSASQS STPQHVACNG GGSALAGTDA AVPESGSADT RMERTPRKSG  780
KKNTEGDQSM LETSKTENSK EGIQTDLFKT PEASQGKMSR KRRKSGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678968.10.0PREDICTED: homeobox protein HAT3.1 isoform X1
TrEMBLA0A0K9QSK50.0A0A0K9QSK5_SPIOL; Uncharacterized protein
STRINGVIT_03s0091g00290.t011e-159(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-109Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain