PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_141550_dcsg.t1
Common NameSOVF_141550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 387aa    MW: 44248.9 Da    PI: 6.6264
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_141550_dcsg.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.86e-5571361129
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                        +ppGfrFhPt+eelv++yL++kv ++++e+ ++ike+d+yk+ePwdL++ +k+   +++ewyfFs++dkky+tg+r+nrat++g+Wkatg+d
  Sp_141550_dcsg.t1   7 VPPGFRFHPTEEELVDYYLRRKVCSRRIEV-DIIKEIDLYKIEPWDLQELCKTgddDQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRD 97 
                        69****************************.99**************953333233556********************************* PP

                NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                        k++++ k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Sp_141550_dcsg.t1  98 KAIYC-KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                        *****.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-595156IPR003441NAC domain
PROSITE profilePS5100558.5947156IPR003441NAC domain
PfamPF023655.9E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MNSSTQVPPG FRFHPTEEEL VDYYLRRKVC SRRIEVDIIK EIDLYKIEPW DLQELCKTGD  60
DDQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YCKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GAPQEEGWAV CRVFKKRTPT TMRRMGGHES PCWYDDHVSF  180
MSDMDSPQQA TQSNNGGLNN YTCKKEFNNN HHHHQHQHQH LPFQIPQEHH HLIHLPLFEN  240
SKMLLPSPHS TGNFNNSGLI PFGIDMSLHS NPTMQQIVNN NNNSNNNNDN ISNTDNNNGS  300
GQDVLDQVTD WRVLDKFVAS QLSHEDVVAK LGHDNNNNNY SSSNVAPGIF PGATAPIVSN  360
LSDKVEDSIP EKASTPTSSN QIDVWKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-49315711169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021842207.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-130NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0K9QW430.0A0A0K9QW43_SPIOL; Uncharacterized protein
STRINGXP_010672023.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-113NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]