PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_140790_ggkr.t1
Common NameSOVF_140790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 356aa    MW: 37756.4 Da    PI: 7.688
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_140790_ggkr.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.91.5e-4366141176
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                        +CqvegC++dls+ak y++rhkvC +hsk+pvv+v+g+eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Sp_140790_ggkr.t1  66 RCQVEGCNVDLSDAKAYYSRHKVCGMHSKSPVVIVAGIEQRFCQQCSRFHRLPEFDQGKRSCRRRLAGHNERRRKP 141
                        6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-3560128IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.44564141IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-4165145IPR004333Transcription factor, SBP-box
PfamPF031104.0E-3367140IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MTVEGSSTSS PGLSDSLNGL KFGQKIYFED VGGGGGGGGG SGKSSGGGGL VKKGGKGVVQ  60
GGQPPRCQVE GCNVDLSDAK AYYSRHKVCG MHSKSPVVIV AGIEQRFCQQ CSRFHRLPEF  120
DQGKRSCRRR LAGHNERRRK PPPGSLLSSR LGRLSASLFG DNTSGSGGFL LDFSSYSRQS  180
ERDLWPSSET SEQVSGSQSR SIMWSGDSED PPPKIFMQGS ANESSYCFPW GECMTGVSSD  240
SSCALSLLSN ETWSSRNRSS GAGLGNSINN DQCSAAHSVT VAQLPSNSSS SRSSWGFKGN  300
NDADCVPSGH LGVGQISQQN FSGPYHGDLL MEHVQDGGRQ YMDVDHSNSN HVDWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-31671401184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021865278.10.0squamosa promoter-binding-like protein 9
SwissprotA3C0577e-64SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A0K9QU540.0A0A0K9QU54_SPIOL; Uncharacterized protein
STRINGXP_010672689.11e-165(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-39squamosa promoter binding protein-like 9