PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_134920_hygk.t1
Common NameSOVF_134920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 364aa    MW: 42229.2 Da    PI: 6.3433
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_134920_hygk.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.24.3e-5571351129
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                        +ppGfrFhPtdeelv++yL++k++++k+   ++ik+vd+yk+ePwdL++  k+++ e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+d
  Sp_134920_hygk.t1   7 VPPGFRFHPTDEELVDYYLREKIAARKMC--DIIKDVDLYKIEPWDLQElcKISNeEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRD 96 
                        69***********************9954..58**************954544442566********************************* PP

                NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                        k+++s k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  Sp_134920_hygk.t1  97 KAIYS-KHNLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 135
                        *****.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-595155IPR003441NAC domain
PROSITE profilePS5100559.3517155IPR003441NAC domain
PfamPF023651.1E-288134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MDTLSHVPPG FRFHPTDEEL VDYYLREKIA ARKMCDIIKD VDLYKIEPWD LQELCKISNE  60
EQNEWYFFSH KDKKYPTGTR TNRATKAGFW KATGRDKAIY SKHNLIGMRK TLVFYKGRAP  120
NGQKSDWIMH EYRLETNENG TPQEEGWVVC RVFKKRMATV RRLDGSPCWY DDQMSFMPDM  180
DSPRRIPHHP NNYHTPNINN SNLNFHPNQQ HNMYPCKQEL EIMPYNISHH DPYLQLPQLE  240
SPKMPQPSMQ QGYGTMLTQD YMIDSTQLDS IYGNGSGNTC GSTEQGLDDE VTDWRVLDKF  300
VASQLSQDEQ HGLSAASKGL SNYSNAPVFP ESEHMNMVIS PNSSNKEDHY ASTSNSSCQI  360
DMWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-46615614169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021855966.10.0NAC domain-containing protein 7-like
SwissprotQ9FWX21e-135NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0K9QW380.0A0A0K9QW38_SPIOL; Uncharacterized protein
STRINGXP_010676181.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-137NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]