PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_133980_jnif.t1
Common NameSOVF_133980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 330aa    MW: 37501.3 Da    PI: 7.3785
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_133980_jnif.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.54.6e-48121383128
                NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                        pGfrFhPt+eel+++yLk+ v+g+k+   ++i  ++iy+++PwdLp  +k +e+ewyfF++rd+k+++g r+nr+t++g+Wkatg+d++++s
  Sp_133980_jnif.t1  12 PGFRFHPTEEELLDFYLKNMVNGRKMYH-DIIGFLNIYRFDPWDLPGLAKIGEREWYFFVPRDRKQSNGGRPNRTTEHGFWKATGSDRKIVS 102
                        9************************888.89***************8888899*************************************99 PP

                NAM  95 k..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            ++++gl+ktLvfykgrap+g+ktdW+m+eyrl
  Sp_133980_jnif.t1 103 LsePKRVIGLRKTLVFYKGRAPRGSKTDWIMNEYRL 138
                        7656778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.90310156IPR003441NAC domain
SuperFamilySSF1019411.96E-5611156IPR003441NAC domain
PfamPF023654.2E-2512138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDDKTSPSFE LPGFRFHPTE EELLDFYLKN MVNGRKMYHD IIGFLNIYRF DPWDLPGLAK  60
IGEREWYFFV PRDRKQSNGG RPNRTTEHGF WKATGSDRKI VSLSEPKRVI GLRKTLVFYK  120
GRAPRGSKTD WIMNEYRLPD NIVLPKDIVL CKIYRKATSL KELEQRAAKE EEKSTNGFAY  180
SYPTSPLSSS NETYSFLDAA TANANANAND VNANVNVNVN ANANASGQFF QDFFTPMSTN  240
DMITTLKKED QTPFVETNCS QVAAAKNVTS NTIQLPFGKE NLELQVPKSG MDWAQDPLFS  300
LSCSPWLENL LNFASPTLIS QTCNQLYFIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-471215617168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021848488.10.0NAC domain-containing protein 35
SwissprotQ10S651e-93NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A0K9QXX30.0A0A0K9QXX3_SPIOL; Uncharacterized protein
STRINGXP_010690266.11e-167(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-108NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]