PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_133560_dkuj.t1
Common NameSOVF_133560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family TCP
Protein Properties Length: 354aa    MW: 36602.6 Da    PI: 6.8961
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_133560_dkuj.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP113.33.3e-3570140373
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                        ++k++++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+ ai+e+tgt++++a ++
  Sp_133560_dkuj.t1  70 VRKRPSKDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIKWLLERAEGAIIEATGTGTIPAIAV 140
                        79*************************************************************99999544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.4E-2975146IPR005333Transcription factor, TCP
PROSITE profilePS5136926.30575129IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEDEENNSHN SSSNNENTNN SRNSGGFPFD PFPPVDQSES TAFSTAALKV EPIDAVTLAA  60
PPPPLPPPMV RKRPSKDRHT KVEGRGRRIR MPAACAARIF QLTRELGHKS DGETIKWLLE  120
RAEGAIIEAT GTGTIPAIAV SVNGTLKIPT TPAGGRDDDY GGKKRRRTNN SDFVDLADVS  180
VGGGGGGVSL SSGLAPITAA NTAAALGFSS AQAPGHHPPP PQGLVPIWPA NFFMLPNAAG  240
IGGGGQQPQF WATPVFGLAA AARPISSFVS EVVQASSGVS NGGNAPPTTA STTTTNLLDF  300
SLEIYDNNKR ELQLMSSRPM NSIHQGISHE QQGGGGGGGS NTTPTPPSSS SQAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00667PBMTransfer from GSVIVG01027588001Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021842292.10.0transcription factor TCP19
SwissprotQ9LT896e-67TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A0K9QYN30.0A0A0K9QYN3_SPIOL; Uncharacterized protein
STRINGXP_010693449.11e-111(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.23e-50TCP family protein