PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_123350_gdgu.t1
Common NameSOVF_123350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 1078aa    MW: 118370 Da    PI: 7.9207
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_123350_gdgu.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.97.7e-40163240178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +Cqv++C++dls+ k+yhrrhkvCe+hsk++++lv +++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+qa
  Sp_123350_gdgu.t1 163 MCQVDNCTEDLSKSKDYHRRHKVCEFHSKSTKALVGKQMQRFCQQCSRFHPLAEFDEGKRSCRRRLAGHNKRRRKTQA 240
                        6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.6E-33157225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.385161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-36162241IPR004333Transcription factor, SBP-box
PfamPF031103.4E-29164237IPR004333Transcription factor, SBP-box
CDDcd002041.26E-7826963No hitNo description
SuperFamilySSF484031.28E-8828968IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.5E-7832971IPR020683Ankyrin repeat-containing domain
SMARTSM00248340867896IPR002110Ankyrin repeat
SMARTSM002483.2912942IPR002110Ankyrin repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1078 aa     Download sequence    Send to blast
MEEVGTQVAS PLFIHQNIGG RFCEGALIGA KRGLCYNSGT NHHQQQQHSQ NHRSGHGWNP  60
KDWEWDSSHF VARNKPIEAS QRVNPILSSS FTSKSSSRVD DQQEQDGGGS LRLQLGGVGD  120
SNVTGTSINK VQSSNSTDDP ASSSRPNKKV RSGSPGTGGN HPMCQVDNCT EDLSKSKDYH  180
RRHKVCEFHS KSTKALVGKQ MQRFCQQCSR FHPLAEFDEG KRSCRRRLAG HNKRRRKTQA  240
EDTPSPPIQP TKTAYGNLDI VNLLTVLARG QGNAEQNVST CPSLPDKNQL IQILSKMNTL  300
PMPLDIATNP LVTPGSTKNG FEQGALMEVN AASRSTTDLL AVLSSTLAAS SPNSVPFISQ  360
RSNPGSCMVK NKSTTGDKDT GSDACKKTAI ELQSLGGERS SSSYQSPTED SDSQVQDTRM  420
NLPLQLFSSS PGDDSSPNLV SSRRYFSSDS SNPTEERSHS STAPVTRKLF PLETTSGSAK  480
PARMSFGEEA NVNIEATSGS RMTLDLFTMG NRAVSNSLQS LPHQAGYTSS SGSDHSPPSF  540
NSDPQKDRTG RIIFKLFDKD PSQLPGALRT QIYNWLSNSP TEMESYIRPG CVVLSIYVSM  600
SSAAWEQLEE SFLQRVEALV QDPDFEFWRS GRFSANIGRQ LAVHKDGRIR ICKPWSTVSS  660
PELFLVSPLA VVSGQSTSLV LGGRNLTSPG TKIHCTYMGG YSSKAVLRSS DEGFTCDEVE  720
LSDFKVHAAA SSVLGRCFIE VENGVRGNCF PVIIADAKIC QELRLLEREF YEAKVGDVVM  780
EDQVQYVASP HSHEEALHFL NELGWLFQRQ LSSDIAVHDF MLHRLQYLLT FSTERDYCAL  840
VKTLLDIFVE AESRMDGLSA ECVEALAKMH LLHRAVKRSS KKMVDMLIHY SAPCGSGASK  900
KYIFPPNLRG PGGITPLHLA ACTSGSYDII DVLTDDPMQI GLHCWKSLVD DSGQSPYSYA  960
LMRNNNAVNN IVARKLSDRI NRQVSVTIGN EIVESFSGTA EMKQRASLKL NTKQNSCSKC  1020
AMMSYGRMQG SHGFLHRPFI HSMLTIAAVC VCVCLFFKSM HVNSVTPFMW DNVDFGAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30153237184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021836587.10.0squamosa promoter-binding-like protein 14
RefseqXP_021836588.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A0K9R1B90.0A0A0K9R1B9_SPIOL; Uncharacterized protein
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]