PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_116880_ggqf.t1
Common NameSOVF_116880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 509aa    MW: 57240 Da    PI: 4.7648
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_116880_ggqf.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.9e-54171432128
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                        ppGfrFhPtdeel+ +yLk+k+++++l+l ++i+evd+yk+eP++Lp  + +k+++++w+fFs+rd+ky++g+r+nrat++gyWkatgkd++
  Sp_116880_ggqf.t1  17 PPGFRFHPTDEELILYYLKRKISRRRLKL-DIIAEVDVYKCEPEELPglSVLKNGDRQWFFFSPRDRKYPNGSRANRATRQGYWKATGKDRP 107
                        8****************************.99***************6448888999*********************************** PP

                NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        + + ++++vg+kktLvfykgrap+g++tdWvmhey l
  Sp_116880_ggqf.t1 108 INC-NSRNVGIKKTLVFYKGRAPTGQRTDWVMHEYVL 143
                        ***.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-6114166IPR003441NAC domain
PROSITE profilePS5100556.18216166IPR003441NAC domain
PfamPF023654.3E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MAASTSIIAA DVDDVWPPGF RFHPTDEELI LYYLKRKISR RRLKLDIIAE VDVYKCEPEE  60
LPGLSVLKNG DRQWFFFSPR DRKYPNGSRA NRATRQGYWK ATGKDRPINC NSRNVGIKKT  120
LVFYKGRAPT GQRTDWVMHE YVLEEDELKR CQNVYDYYVI YKVFKKSGPG PKNGEQYGAP  180
FREEDWAEDD CPQLQSTSSC NQICAAQQVV NVLPTVYCPN EQLDLSVNDI DELLNRVLDE  240
PAPLPVNDDD FEQALSQFFG EEGNQSVVTN QSSFEQVTTL LREDDFIEMD DLFAPEPLQG  300
LSTGLLQPIG GEISGNSHLR VEDDGLSQFD LYYDADAILH QLTGDDHHQT ASLSQYHHSS  360
QSHESELVSE MWTYDPNIFP VNSTVPSSGV VYDDGISGLN QNQEAESSQP WSSSSLWSLV  420
DSIHAPPASA AESSVLLNKA FQRMSSFSRI RLNSRIIIPA AVAGRASKSS SRIKGYFFFS  480
FLAALFAVLC VFIGSNASVF GKLHCRMKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-491714316140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021864348.10.0NAC domain-containing protein 17-like isoform X1
TrEMBLA0A0K9R3R70.0A0A0K9R3R7_SPIOL; Uncharacterized protein
STRINGXP_010696509.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.12e-90NAC domain containing protein 17