PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_112880_awsp.t2
Common NameSOVF_112880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 109aa    MW: 12611.8 Da    PI: 7.859
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_112880_awsp.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-412398277
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                       Cq+++C++dl++ak+yhrrhkvCe+h+kapvv+v+ ++qrfCqqCs+fh++sefD++krsCrrrLa+hnerrrk++
  Sp_112880_awsp.t2 23 CQADNCTSDLTDAKRYHRRHKVCEFHAKAPVVIVNSKHQRFCQQCSKFHDVSEFDDTKRSCRRRLAGHNERRRKNS 98
                       **************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-322084IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.9922097IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-3821101IPR004333Transcription factor, SBP-box
PfamPF031102.0E-312396IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MEGFNNDDDH FMGGSLPNVD VYCQADNCTS DLTDAKRYHR RHKVCEFHAK APVVIVNSKH  60
QRFCQQCSKF HDVSEFDDTK RSCRRRLAGH NERRRKNSYD VSAESSSAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-341396184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021835590.11e-68squamosa promoter-binding protein 1-like
SwissprotQ387412e-39SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A0K9R2V14e-75A0A0K9R2V1_SPIOL; Uncharacterized protein
STRINGXP_002509450.12e-43(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.15e-40squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]