PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_103190_meji.t1
Common NameSOVF_103190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 415aa    MW: 46393.4 Da    PI: 5.1535
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_103190_meji.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-53361631128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                        l+pGfrFhPtd+elv++yLk+k+ gk++++ ++i+e+diyk+ePwdLp  +k+k++++ewyfF  +d+ky +g+r nrat +gyWkatg+d+
  Sp_103190_meji.t1  36 LAPGFRFHPTDQELVSYYLKRKICGKPIRF-DAISETDIYKSEPWDLPdlSKLKSRDNEWYFFGVQDRKYVNGSRVNRATGKGYWKATGNDR 126
                        579**************************9.99**************965599999************************************ PP

                NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++++ + ++vg+kktLvfy+grap g++t+Wvmheyrl
  Sp_103190_meji.t1 127 PIIH-NFRTVGMKKTLVFYSGRAPCGKRTNWVMHEYRL 163
                        ****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-6134186IPR003441NAC domain
PROSITE profilePS5100557.3736186IPR003441NAC domain
PfamPF023654.6E-2738163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MGTEPPPPLL PPPQPPSPQP LMLLPPPPPT ETATSLAPGF RFHPTDQELV SYYLKRKICG  60
KPIRFDAISE TDIYKSEPWD LPDLSKLKSR DNEWYFFGVQ DRKYVNGSRV NRATGKGYWK  120
ATGNDRPIIH NFRTVGMKKT LVFYSGRAPC GKRTNWVMHE YRLTDDELAK SGVVLDAYLL  180
CKILKKSGPG FKPGEQYGPF VEEEWEKDVS TLVPGEEGDD ETAVNDDARV EDSILSMNNS  240
ESGPISSCGL STEVQEIPPL CKVERTEEGP IACTVDPEPL SLGPNKRQRR SEFDSCHSNG  300
ASDISTTITQ GPCSSSTGTT NFSSGRLDFP LLESVSVEPK QRPSPPTNVI DINVPPSYLK  360
LFEELRNEIY RTSIEKESLK IEVMSARTMI NILQTKIDHL TKENEELKKS NSRDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-49301879169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021864947.10.0NAC transcription factor 29-like
TrEMBLA0A0K9R5V80.0A0A0K9R5V8_SPIOL; Uncharacterized protein
STRINGXP_010694507.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.27e-98NAC domain containing protein 52