PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_099080_miwo.t1
Common NameSOVF_099080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Dof
Protein Properties Length: 447aa    MW: 49445.6 Da    PI: 5.3211
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_099080_miwo.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.1e-39106165261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Sp_099080_miwo.t1 106 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKSS 165
                        7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-31103163IPR003851Zinc finger, Dof-type
PfamPF027011.9E-32108164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.891110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MMDPAIKLFG KTIPVIGDEE SPRYESTNES SNSELHDVDD KDFTEDKMEI IQSDDPAPPS  60
EEDSTNPQIT SNTDDNDNDK ASDSEEMDEK DSNDQKNSQQ KTLKKPDKIL PCPRCNSMDT  120
KFCYYNNYNV NQPRHFCKSC QRYWTAGGTM RNVPVGAGRR KNKSSAPRYC HITVSEALQA  180
ARLDGPNGIH HPGLKPNGTV LTFGPDNPLC DSMLNIGDKK VLNGTNATTT RNGFHDIDQV  240
VRRSKENGDD RSCGSTVTTT SSMDDKAKAG PQQNLNGFTN QMPCYQWPYV WNPAVPVPPF  300
CPSAFPPMPF YPPPYWNGAM PWNFPWNFPT QSSPGSNSNS PTLGKHTRDG EMVNQSENER  360
SLGTSTVLVP KTLRIDDPDE AAKSSIWTTL GIKKGDSKSK GGGFFNSLQQ SKKVVDNSNS  420
HNIMDASPEL QANPAALQRS MNFQESA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678506.10.0PREDICTED: cyclic dof factor 3 isoform X2
SwissprotQ8LFV31e-108CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A0K9R7520.0A0A0K9R752_SPIOL; Uncharacterized protein
STRINGVIT_17s0000g06310.t011e-133(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-98cycling DOF factor 3