PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_098310_sjnz.t1
Common NameSOVF_098310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 394aa    MW: 43190.9 Da    PI: 9.3959
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_098310_sjnz.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.75.8e-4295171278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        C v+gC+adls++++yhrrhkvCe+hsk+p v++ g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Sp_098310_sjnz.t1  95 CLVDGCKADLSKCRDYHRRHKVCEMHSKTPRVTIGGHEQRFCQQCSRFHSLGEFDEGKRSCRKRLEGHNRRRRKPQP 171
                        **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.2E-3587156IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.09492169IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-3993174IPR004333Transcription factor, SBP-box
PfamPF031107.7E-3195168IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MGYNLKKKYS DKAELEKKGI AIISAIFGSS NFDKEKAKGE SLVDLELEKL GDIGKGFANN  60
LKGHRTTLMD PFSSTAGSSK RPRTPGGSSG QLVSCLVDGC KADLSKCRDY HRRHKVCEMH  120
SKTPRVTIGG HEQRFCQQCS RFHSLGEFDE GKRSCRKRLE GHNRRRRKPQ PEPLPVNHGN  180
FFSTSQGSRF LAFSNQPIIP ATSSVVSTAW SGAVKSESNP TLYNSPVSSS SYSQSYRGRQ  240
FPFLQVPESS LTGVSSTFHH DPNNGDNNNN QKSPVFCNSL NQVIDSDRAL SLLSSSNAET  300
PEMGLGRVIH HPSPINPTRP MLSSLHYSSL TPQYPGSSQT QAQAQAHGLE VHPQGSGLFS  360
DLRTNNSLCQ NVFQNETDAS SANGGHQTLS FSWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2887168484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151168KRSCRKRLEGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021845911.10.0squamosa promoter-binding-like protein 13A
RefseqXP_021845912.10.0squamosa promoter-binding-like protein 13A
RefseqXP_021845913.10.0squamosa promoter-binding-like protein 13A
SwissprotQ6YZE83e-58SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBLA0A0K9R8X40.0A0A0K9R8X4_SPIOL; Uncharacterized protein
STRINGXP_010682726.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-51SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY
    High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice.
    Theor. Appl. Genet., 2011. 122(8): p. 1489-96
    [PMID:21327937]
  3. Wang S, et al.
    Control of grain size, shape and quality by OsSPL16 in rice.
    Nat. Genet., 2012. 44(8): p. 950-4
    [PMID:22729225]
  4. Wang S, et al.
    The OsSPL16-GW7 regulatory module determines grain shape and simultaneously improves rice yield and grain quality.
    Nat. Genet., 2015. 47(8): p. 949-54
    [PMID:26147620]
  5. Wang Y, et al.
    A comprehensive meta-analysis of plant morphology, yield, stay-green, and virus disease resistance QTL in maize (Zea mays L.).
    Planta, 2016. 243(2): p. 459-71
    [PMID:26474992]
  6. Lee CM, et al.
    Influence of Multi-Gene Allele Combinations on Grain Size of Rice and Development of a Regression Equation Model to Predict Grain Parameters.
    Rice (N Y), 2015. 8(1): p. 33
    [PMID:26519289]
  7. Bessho-Uehara K, et al.
    Loss of function at RAE2, a previously unidentified EPFL, is required for awnlessness in cultivated Asian rice.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(32): p. 8969-74
    [PMID:27466405]