PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_092060_ukro.t1
Common NameSOVF_092060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 285aa    MW: 32364 Da    PI: 9.3156
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_092060_ukro.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-42149225278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        CqvegC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+++
  Sp_092060_ukro.t1 149 CQVEGCNADLSNAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSNN 225
                        **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-35145210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.821146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-39147226IPR004333Transcription factor, SBP-box
PfamPF031102.3E-32149222IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MLRYEWNNNH SSPPPNLILS DIDLHHHHNH NHNSYNHNHD FSTPPSSHRP MFDDSFSMPC  60
TFPQDNNPQQ VPLFSDPRAF PTAASSSLLT LESLSSVMHI PKAEPDIFTN RPIGLNLGRR  120
TYFSADDDLI SRLYRRSRAV EPALHTPKCQ VEGCNADLSN AKHYHRRHKV CEFHSKASTV  180
IAAGLTQRFC QQCSRFHLLS EFDNGKRSCR KRLADHNRRR RKSNNQRTLP TVLSMSPGEN  240
AQTSPSQNTL RSPSDSGMNS SSSVTIAVSP PRVSFDSSFM QRSYE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-321492221184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021849322.10.0squamosa promoter-binding-like protein 8
SwissprotQ8GXL34e-67SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A0K9R9E30.0A0A0K9R9E3_SPIOL; Uncharacterized protein
STRINGXP_010692128.11e-130(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-67squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]