PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_071320_ekpp.t1
Common NameSOVF_071320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Dof
Protein Properties Length: 347aa    MW: 37888.1 Da    PI: 7.1229
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_071320_ekpp.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.72.5e-3892151261
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grr+nk+ 
  Sp_071320_ekpp.t1  92 PDKILPCPRCNSSDTKFCYFNNYNVNQPRHFCKSCQRYWTAGGTVRNVPVGAGRRRNKHL 151
                        68999*****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2885149IPR003851Zinc finger, Dof-type
PfamPF027019.9E-3294150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.72396150IPR003851Zinc finger, Dof-type
PROSITE patternPS01361098134IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MAATAVKDPA IKLFGRTICL PESQFSDDSE ILDNRSSLIA KEETEECRNE NTVIPDQAVS  60
TKRAITAQTT MKPKDQQEDS DSAGEQKQMR RPDKILPCPR CNSSDTKFCY FNNYNVNQPR  120
HFCKSCQRYW TAGGTVRNVP VGAGRRRNKH LASQYRQVIA SSDGGETMVA EVTDSENQLR  180
SCEESSSSCT GSSSKEMVLK FGPESPHCDN STPNLLSNRQ SNECSEIRGV NGDFPQLYHY  240
VVPPQVTGSS PHSNGSVSLA VPGYASPNVS YQIVPAAYMN CIPVWVAGSG NLSLAMSNGC  300
VSPSLYSSGS RLQVLGKHSR DINQAHERRT EEGAAPKTIK IHGLDEA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695534.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLA0A0K9RHF40.0A0A0K9RHF4_SPIOL; Uncharacterized protein
STRINGVIT_08s0056g01230.t016e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-42cycling DOF factor 2