PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_068500_rmfu.t2
Common NameSOVF_068500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 347aa    MW: 38276.3 Da    PI: 9.4572
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_068500_rmfu.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM93.73e-292710252128
                NAM  52 kaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ew+fFs+r kky++g++++rat+ gyWkatgk+++v+s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Sp_068500_rmfu.t2  27 INSDQEWFFFSPRGKKYPNGSQSKRATQIGYWKATGKERAVKS-GSNVIGTKRTLVFHIGRAPKGERTEWIMHEYCM 102
                        35689*************************************9.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.6841118IPR003441NAC domain
PfamPF023654.3E-1420101IPR003441NAC domain
SuperFamilySSF1019413.14E-3327118IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MALTNVLKSS LKLTSASSSP GTCLAIINSD QEWFFFSPRG KKYPNGSQSK RATQIGYWKA  60
TGKERAVKSG SNVIGTKRTL VFHIGRAPKG ERTEWIMHEY CMSGKAQDAL VVCRLRRKSD  120
YQAMNGGPNG EIQSPDPSSL MASSGTYSGC GIMELINTSA RDKLVAECSF KKSSSSHDSH  180
SVEQMDSASQ SDWKAKDEII QPESTSNNHV GNEDDLFAEI LNDSIIQLDE CLPPATIGVQ  240
SIVTNNTTVP IVPHLHNNPP HQSNVQRVHP SQGTANRRIR LRKLRRFSPC KDELEESLGE  300
NTVSSKPKQL TKGRGWARVL NNYARLYVVV ITMALVILAY TTAPAYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-242711867165NO APICAL MERISTEM PROTEIN
1ut4_B1e-242711867165NO APICAL MERISTEM PROTEIN
1ut7_A1e-242711867165NO APICAL MERISTEM PROTEIN
1ut7_B1e-242711867165NO APICAL MERISTEM PROTEIN
3swm_A1e-242711870168NAC domain-containing protein 19
3swm_B1e-242711870168NAC domain-containing protein 19
3swm_C1e-242711870168NAC domain-containing protein 19
3swm_D1e-242711870168NAC domain-containing protein 19
3swp_A1e-242711870168NAC domain-containing protein 19
3swp_B1e-242711870168NAC domain-containing protein 19
3swp_C1e-242711870168NAC domain-containing protein 19
3swp_D1e-242711870168NAC domain-containing protein 19
4dul_A1e-242711867165NAC domain-containing protein 19
4dul_B1e-242711867165NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276282RRIRLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021859686.10.0NAC domain-containing protein 89-like
TrEMBLA0A0K9RGM40.0A0A0K9RGM4_SPIOL; Uncharacterized protein
STRINGXP_010692710.11e-141(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.12e-57NAC domain containing protein 60