PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_052960_tidn.t1
Common NameSOVF_052960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 342aa    MW: 38807.6 Da    PI: 6.6784
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_052960_tidn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.51.1e-56171431129
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtdeel+++yL++kv + ++++ ++i evd++k+ePwdLpk++k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+
  Sp_052960_tidn.t1  17 LPPGFRFHPTDEELISHYLAPKVVDINFSA-KAIGEVDLNKCEPWDLPKRAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEI 107
                        79**************************99.88***************99999*************************************** PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                        ++ +++lvg+kktLvfykgrapkgek++Wvmheyrle
  Sp_052960_tidn.t1 108 YR-GKSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLE 143
                        **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6513167IPR003441NAC domain
PROSITE profilePS5100560.35917167IPR003441NAC domain
PfamPF023652.0E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEKMVVIHGD DHEPMELPPG FRFHPTDEEL ISHYLAPKVV DINFSAKAIG EVDLNKCEPW  60
DLPKRAKMGE KEWYFFCVRD RKYPTGLRTN RATEAGYWKA TGKDKEIYRG KSLVGMKKTL  120
VFYKGRAPKG EKSNWVMHEY RLEGKSSLQN LPSNAKNEWV ICRVFQKSAA GKKIPFHGII  180
QQESEFNPSS NLPPLMDYNT SYGAPHVPCF SNPPMEMETT TAHYQNTNQT SFEGLMSNPY  240
KSNNTGDNPY FSYFPSQTGN YSGNYMMSDQ HILKTILGTE MKQSMKTEVV NYSASQDTGL  300
SSDMNAEISS VVSNYDISRR AFDDHDGPST SGGPVDLDTL WY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-5641737174NAC domain-containing protein 19
3swm_B3e-5641737174NAC domain-containing protein 19
3swm_C3e-5641737174NAC domain-containing protein 19
3swm_D3e-5641737174NAC domain-containing protein 19
3swp_A3e-5641737174NAC domain-containing protein 19
3swp_B3e-5641737174NAC domain-containing protein 19
3swp_C3e-5641737174NAC domain-containing protein 19
3swp_D3e-5641737174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021860565.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-128NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0K9RN470.0A0A0K9RN47_SPIOL; Uncharacterized protein
STRINGXP_010678483.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-130NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]