PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_052390_ftsp.t1
Common NameSOVF_052390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Dof
Protein Properties Length: 366aa    MW: 39848.9 Da    PI: 8.3421
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_052390_ftsp.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.36.9e-3882141362
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        e+ +kcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+  k+s
  Sp_052390_ftsp.t1  82 EAGQKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGSRRTTKRS 141
                        56789************************************************9987764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3165130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.78985139IPR003851Zinc finger, Dof-type
PfamPF027019.4E-3285139IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MVFSSLPLYQ LDPQNWHQQS NDHQQQQQQQ QQPPLLSAHH DSNGGQLPPG QPNHGGDGGG  60
GSITKPNSMV DRARQAQIPL PEAGQKCPRC DSTNTKFCYF NNYSLSQPRH FCKTCRRYWT  120
RGGALRNVPV GGGSRRTTKR SKSRSSSSGG GGGGGGGSNN EASRSPMIST CTTTNSGGSS  180
CSTSLFLTPN NNNMMNIMPQ FPFLPSSLHH HHLGNSNPNG IGLSLLGGGG VEMEFPFMGN  240
NFEGLGRING MMQHMHPFDQ NNTTTPGSSV ELLGGRLMPN HHHHHHHNAA FQSRPPLDHE  300
VGIDDRSVAS VKLEDSQRLS LLAKDFEVVQ PNEHHQHQYN NWNSSVWSNS DISGFISPSS  360
TSHLLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140RRTTKRS
2147157SGGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9RNF70.0A0A0K9RNF7_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.14e-37DNA binding with one finger 2.4