PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_042070_dnka.t1
Common NameSOVF_042070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 573aa    MW: 65300.8 Da    PI: 5.5449
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_042070_dnka.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM63.18.8e-2025180129
                NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                        +g+Wkatg+dk+v++k+ +l+g++ktLv+ykgrap+g+k+dW+mheyrle
  Sp_042070_dnka.t1   2 AGFWKATGRDKAVYDKGFKLIGMRKTLVYYKGRAPNGQKSDWIMHEYRLE 51 
                        69**********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.247171IPR003441NAC domain
SuperFamilySSF1019413.01E-23271IPR003441NAC domain
PfamPF023654.0E-8350IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MAGFWKATGR DKAVYDKGFK LIGMRKTLVY YKGRAPNGQK SDWIMHEYRL ETDENGPPQE  60
EGWVVCRAFK KKTTIQSKTM ERWDSSSSSP SCMLYDHEPS GISSVIDPII IHNNGEFAMQ  120
RNRLLHKKSL CKEESLDQSW INFMHSTSSL DDSFLQLPQL ESPSSQPPFL KRVCTTTATA  180
TTAVTTTSQD WRELDQFVAS QLSEDALLLL HGSNNEREEL EEEKEKQVEA ITEIGFGGLL  240
SVHIPDINKK LICWILENFN SMGHMLQLGK GREYKIQLYD YDVYDVFDLP WVKDVDVEET  300
PRKRSEGDAT HAMLQRWFTK FNKKDTAQAP YLTELEIYLA NTDDYGDNFK RAFVIFALGV  360
YLAPTSNPML DIKLLKAVED VSRIAKQNWF KYVLNHLGSA VERWRENYGN SRVGGCLQFL  420
EIIYLQRSLF RGVTPRMEIP LVQHWFPAEV SARMIQFSIP EGIETNAEIE QVCNDELQSA  480
MKFYCRDLYV VSNFHQQRIN QIKANRRELS DRPGYGDPMF LEIVDSIVAY AVDLKKDNNV  540
GAGSDGDNPA VGGSGINVDV HGSTPKNAKD SGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-1627695170NO APICAL MERISTEM PROTEIN
1ut4_B2e-1627695170NO APICAL MERISTEM PROTEIN
1ut7_A2e-1627695170NO APICAL MERISTEM PROTEIN
1ut7_B2e-1627695170NO APICAL MERISTEM PROTEIN
3swm_A2e-1627698173NAC domain-containing protein 19
3swm_B2e-1627698173NAC domain-containing protein 19
3swm_C2e-1627698173NAC domain-containing protein 19
3swm_D2e-1627698173NAC domain-containing protein 19
3swp_A2e-1627698173NAC domain-containing protein 19
3swp_B2e-1627698173NAC domain-containing protein 19
3swp_C2e-1627698173NAC domain-containing protein 19
3swp_D2e-1627698173NAC domain-containing protein 19
4dul_A2e-1627695170NAC domain-containing protein 19
4dul_B2e-1627695170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2177752e-36AB217775.1 Zinnia elegans Ze567 mRNA for NAC-domain protein Ze567, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021836934.11e-164uncharacterized protein LOC110776693
RefseqXP_021850345.11e-166uncharacterized protein LOC110789932
TrEMBLA0A0K9RRL00.0A0A0K9RRL0_SPIOL; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.16e-49vascular related NAC-domain protein 1