PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_041020_ixtj.t1
Common NameSOVF_041020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 399aa    MW: 44492.7 Da    PI: 6.0922
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_041020_ixtj.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.91.9e-40130205277
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                        Cqv gC++dls+ k+y+rrhkvC+vh+k+p v+v+g+eqrfCqqCsrfh l efD+ krsCr+rL+ hn+rrrk+q
  Sp_041020_ixtj.t1 130 CQVLGCNKDLSSYKSYYRRHKVCDVHTKTPIVTVDGIEQRFCQQCSRFHLLAEFDDIKRSCRKRLSAHNKRRRKPQ 205
                        **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-31125191IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.966127204IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-37129207IPR004333Transcription factor, SBP-box
PfamPF031103.3E-31130203IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MDSWKYIGTE IKPICNVESY PLISNTQALE RLDFMDLGFA DDIRKSYSIS SEPSGEVFSD  60
EIGTDYPQFG EESNKHDFSL VDLKLGMLDD GGIAVDSELS KTNAPEPSIM LSSPAKKARS  120
SMSTMRSSSC QVLGCNKDLS SYKSYYRRHK VCDVHTKTPI VTVDGIEQRF CQQCSRFHLL  180
AEFDDIKRSC RKRLSAHNKR RRKPQLTSDQ GSGTIDFSSS PAFPEVMPSV FLGPSKYEQR  240
IENSIKSSNF LLQMGCVGEN INNVSNVKDG IVSFAKPTIQ NLSSIQQTSC ALSLLSDQSH  300
NLSSQLLDTT STSLINRSIH ADSNLEYALN HSAGNFREVA PHESVICSMD QTDREEPTTI  360
NGTDCHHPKQ RGMILNLLQL SSNLQRVEQQ RHSPENEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-261302031184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186203KRSCRKRLSAHNKRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021867505.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A0K9RQ590.0A0A0K9RQ59_SPIOL; Uncharacterized protein
STRINGXP_010680649.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.18e-36squamosa promoter binding protein-like 9