PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_038920_kxzf.t1
Common NameSOVF_038920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 326aa    MW: 37107.4 Da    PI: 5.0971
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_038920_kxzf.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.65e-5361331128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                        lppGfrFhPtdeelv +yLk+kv+g+++el evi+ +d yk++Pw+Lp k  + +++ ew+fF +rdkky++g+r+nrat++gyWkatgkd+
  Sp_038920_kxzf.t1   6 LPPGFRFHPTDEELVGYYLKRKVQGEEIEL-EVIPVIDFYKFDPWELPdKsFLPKRDMEWFFFYPRDKKYPNGSRSNRATRAGYWKATGKDR 96 
                        79****************************.99**************96434556788********************************** PP

                NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +v++ +++ +g +ktLvfy+grap g++tdWvmheyrl
  Sp_038920_kxzf.t1  97 KVVC-ESSMTGYRKTLVFYQGRAPLGSRTDWVMHEYRL 133
                        ****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-584152IPR003441NAC domain
PROSITE profilePS5100557.7666153IPR003441NAC domain
PfamPF023658.4E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MEGSTLPPGF RFHPTDEELV GYYLKRKVQG EEIELEVIPV IDFYKFDPWE LPDKSFLPKR  60
DMEWFFFYPR DKKYPNGSRS NRATRAGYWK ATGKDRKVVC ESSMTGYRKT LVFYQGRAPL  120
GSRTDWVMHE YRLCDEMSPN SQGTFALCRV VKRSGFNEQV KGKRVGRSSS SKELLSISSD  180
NQDNSSNYST PVSSPYITPR ADFETTASLS SQSPSMWVSP DLILDSSTEY SQGKRMATEY  240
FPQCDFQNPI TSWQPYQQQQ GISPSSSYAT FTEIEHVDDL TQIGCISPFS TNMDYMEYGG  300
NVELWSSGVL LVCYCSPAGN LQPSES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51515316165NO APICAL MERISTEM PROTEIN
1ut4_B2e-51515316165NO APICAL MERISTEM PROTEIN
1ut7_A2e-51515316165NO APICAL MERISTEM PROTEIN
1ut7_B2e-51515316165NO APICAL MERISTEM PROTEIN
3swm_A2e-51515319168NAC domain-containing protein 19
3swm_B2e-51515319168NAC domain-containing protein 19
3swm_C2e-51515319168NAC domain-containing protein 19
3swm_D2e-51515319168NAC domain-containing protein 19
3swp_A2e-51515319168NAC domain-containing protein 19
3swp_B2e-51515319168NAC domain-containing protein 19
3swp_C2e-51515319168NAC domain-containing protein 19
3swp_D2e-51515319168NAC domain-containing protein 19
4dul_A2e-51515316165NAC domain-containing protein 19
4dul_B2e-51515316165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9335311e-156KJ933531.1 Suaeda liaotungensis putative NAC transcription factor (NAC4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021852891.10.0NAC domain-containing protein 71-like isoform X1
SwissprotO496977e-99NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A0K9RQU30.0A0A0K9RQU3_SPIOL; Uncharacterized protein
STRINGXP_010677286.11e-178(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.15e-96NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]