PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_032420_fmtu.t1
Common NameSOVF_032420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 994aa    MW: 110669 Da    PI: 5.935
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_032420_fmtu.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.41.5e-41127203278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        CqvegC +dls+ak+yhrrhkvCe+hska+++lv++++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+q+
  Sp_032420_fmtu.t1 127 CQVEGCVSDLSKAKDYHRRHKVCEMHSKATNALVANIMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQP 203
                        **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.052124201IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.103.0E-32124188IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-38126206IPR004333Transcription factor, SBP-box
PfamPF031101.6E-29127200IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.59E-9763882IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.3E-7765880IPR020683Ankyrin repeat-containing domain
CDDcd002047.60E-7766880No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 994 aa     Download sequence    Send to blast
MEQAHRYHHH SIGTTELRVM GKRGLEWDLN DWKWDGDLFI ATPSNFQGQQ KFIPVNSSNT  60
SSSCSDDVQS AVDDDGRREL ERKRRVIVVE DDSLDESGNL TLKLGAPHMD YDNHNSGKKT  120
KFAGALCQVE GCVSDLSKAK DYHRRHKVCE MHSKATNALV ANIMQRFCQQ CSRFHALQEF  180
DEGKRSCRRR LAGHNKRRRK TQPEAAVQGN SLHDEQTNSV LLMSLLRILS NMHGNNRSNQ  240
TTDQDLVAQL LKSLANPSGL PTGKGLSGLL HESQKLLNGG MATGIGNSEK MLAFLSNGHL  300
NPPRVIDQNI PLPESEIPRK GLYAANSRGG EMQALSVQEP ISLFPIKDSP PTYSESIEGR  360
MKLNNFDLND AYVDSDDGME DLERSPANVT FATGSVDFPS WAGQDSHQSS PPQTSGNSDS  420
ASAPSPSSSS GEGQSRTDRI VFKLFGKEPS DFPTVLLGQI LDWLAHSPTE IESYIRPGCI  480
ILTIYLCLDE SLWEELCSDL SSCLTRLFDI SDDIFWRTGW VYVQVQNQIA LAHNGQVVLD  540
TSLSLQNSNC SRIMSVMPIA VSMDEQARFE VRGFNLSRSN TRLLCALEGK YLDQEATQES  600
TEDDAFVEEE GEIEHADLSC IIPNVTGRGF IEVEDHGLSN SFFPFIVAEK DICSEIRTLE  660
SVLKKNNEDA YGLNNKTLES WHQAMDFINE MGWLLHRSHL KSRLGDQDPN TIIFSFRRFK  720
WLMDFSMDHD WCAVVKKLLD IVVAGTTVGL GEHPSLKVAV SEMGLLHRAV RRNSRPMVEL  780
LLRYVPVNVN VNLSEEFIPS NDDDDGKERF LFRPDAQGPA GLTPLHVAAG TDGSENILDA  840
LTNDPGKNGI EAWKNARDST GATPEDYARL RGHYSYIHLI QRKIYRSSAS ASGHVVVDIP  900
GVASGAVSSF EVGRTAPFNL NQNQNCKVCD QKKMSVYYAR NRTTRTSLVY RPAMLSMVGI  960
AAVCVCVALL FKSMPNVVCL FQPFRWEMLN YGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-311262001084squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021839735.10.0squamosa promoter-binding-like protein 1
RefseqXP_021842942.10.0squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A0K9RUQ70.0A0A0K9RUQ7_SPIOL; Uncharacterized protein
STRINGXP_010678887.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]