PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_028800_hini.t1
Common NameSOVF_028800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 345aa    MW: 38199.8 Da    PI: 8.5594
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_028800_hini.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.67.1e-55151421128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhP+deel+++yL +k+++ ++++ +++++vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+
  Sp_028800_hini.t1  15 LPPGFRFHPSDEELITFYLVNKISDATFSC-RAVADVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEI 105
                        79****************************.88***************99999*************************************** PP

                NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +++ ++elvg+kktLvfy+grap+gekt+Wvmheyr+
  Sp_028800_hini.t1 106 FNSvTTELVGMKKTLVFYRGRAPRGEKTNWVMHEYRV 142
                        *9988999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6411163IPR003441NAC domain
PROSITE profilePS5100560.03515163IPR003441NAC domain
PfamPF023656.1E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MEGGDNQIQA KDESLPPGFR FHPSDEELIT FYLVNKISDA TFSCRAVADV DLNKCEPWDL  60
PGKAKMGEKE WYFFSLRDRK YPTGVRTNRA TNTGYWKTTG KDKEIFNSVT TELVGMKKTL  120
VFYRGRAPRG EKTNWVMHEY RVHSRSAYRS AKDEWVVCRV FQKSAGIKKY PTTTTTQSTS  180
TRAINLEMGQ NHHILTSPML PLDPTHFNLG RTYMMNNHVD QLAELTRALR SNGGATTANM  240
PIHSHINYPL GGHGGGGGGG GGGFTISGLN LNLGGAGGSV SQGPPPLRPM INQQDGQHDV  300
TSSMLSGLET GYVQLDMNIN GHGGSSSRFM NVDNCVEYDN YWPTY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-561416916171NO APICAL MERISTEM PROTEIN
1ut4_B5e-561416916171NO APICAL MERISTEM PROTEIN
1ut7_A5e-561416916171NO APICAL MERISTEM PROTEIN
1ut7_B5e-561416916171NO APICAL MERISTEM PROTEIN
3swm_A7e-561416919174NAC domain-containing protein 19
3swm_B7e-561416919174NAC domain-containing protein 19
3swm_C7e-561416919174NAC domain-containing protein 19
3swm_D7e-561416919174NAC domain-containing protein 19
3swp_A7e-561416919174NAC domain-containing protein 19
3swp_B7e-561416919174NAC domain-containing protein 19
3swp_C7e-561416919174NAC domain-containing protein 19
3swp_D7e-561416919174NAC domain-containing protein 19
4dul_A5e-561416916171NAC domain-containing protein 19
4dul_B5e-561416916171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021860809.10.0protein CUP-SHAPED COTYLEDON 3
RefseqXP_021860810.10.0protein CUP-SHAPED COTYLEDON 3
RefseqXP_021860811.10.0protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A0K9RTX10.0A0A0K9RTX1_SPIOL; Uncharacterized protein
STRINGXP_010669469.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-102NAC domain containing protein 38