PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_011410_jgxg.t1
Common NameSOVF_011410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family SBP
Protein Properties Length: 793aa    MW: 88803.2 Da    PI: 6.7302
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_011410_jgxg.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1179.9e-37132208278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        Cqv+gCe+d+ e+k yhrrh+vC v+++a++vl++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k++
  Sp_011410_jgxg.t1 132 CQVPGCEVDIRELKGYHRRHRVCLVCANASSVLIDGQSKRYCQQCGKFHVLSDFDEGKRSCRRKLERHNNRRRRKSS 208
                        *************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-28128193IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.804129206IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-34130210IPR004333Transcription factor, SBP-box
PfamPF031101.3E-27132206IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MDLPPLTGGG EESGTPFEWS DLFDFTIDDQ LLLNLDSSDN QKIQIETPVV TPAAGGDGEG  60
FGKTLPVNGG GEGSADRVRK RDPRMICENF LAGRVPCACP ELDAMMAEEE EEEAGPGKKR  120
PRMGRTPGVA KCQVPGCEVD IRELKGYHRR HRVCLVCANA SSVLIDGQSK RYCQQCGKFH  180
VLSDFDEGKR SCRRKLERHN NRRRRKSSDF RGAVEKEPLG DVQTEDVFSD GEAGKDNAWS  240
SSQIAEREDS KDGTLSNLCS ALESQNIESD SVLTFTQVNK VIDNLEQDSS PPSDTKSAYS  300
SVCPTGRISF KLYDWNPAEF PRRLRHQIFQ WLASMPVELE GYIRPGCTIL TIFVSMPQYM  360
WVKLFDDPVS YVQSSVGVGG ILSGRGAALV YLNDTSFRIM REGASVMKVK VAVRTPKLHY  420
VYPPCFEAGK PMDLLACGSN LLQPKFRSLI SFAGKYLAHD YYVAFPRGKG EDKPTIDHDR  480
QFCRIYVPHT EPSYFGPAFV EVENECGLSN FIPILIGDEH VCSEIKMIHQ KHDCSYCRKK  540
LHCKSSGSSY GTCEISCSRQ AALSEFMLDV AWLLKRPCSE KLHCILTCSQ IQRYNGLLKF  600
LISNRSTSIL EKILQSLQIV FDEVDSCDVT NDDTDIDRRL LKEHIVHAKD FLRQSAHKKE  660
LILHQAEGCI PKVDKCLGSF AHDDLLPVDR TACQVTEMRV DNNCTVLEYS NSQNEGESIS  720
LINGEVTMNV KDNREWARKS CNNVISKKFV NTRPLVYMIA VVAVCFGVCA VVLHPYKVTK  780
IAVTIRRCVF DNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A5e-38129214388squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192204RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021849148.10.0squamosa promoter-binding-like protein 7
TrEMBLA0A0K9RZG70.0A0A0K9RZG7_SPIOL; Uncharacterized protein
STRINGXP_010666331.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7