PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_004030_rqud.t1
Common NameSOVF_004030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Dof
Protein Properties Length: 399aa    MW: 42342.6 Da    PI: 7.2828
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_004030_rqud.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-3967127262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        ++++lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rkn+k+s
  Sp_004030_rqud.t1  67 HDQHLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNNKKS 127
                        6899*****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2861121IPR003851Zinc finger, Dof-type
PfamPF027018.1E-3368125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.03171125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MMAHSSLQVC MDSSDWLQGG TMSEELSTGL DSSSPPSGGT PTDCMLAAAC SSRAGPPLME  60
RRLRPPHDQH LKCPRCDSTH TKFCYYNNYS LSQPRYFCKT CRRYWTKGGT LRNIPVGGGC  120
RKNNKKSTSK KSNDDQQQQS PLNLVVQGGG GGGGGLIGSN LSHNNAIDHL HHLSFPHGEV  180
QFPPHLAHLI NAQMSLAGGG GGGFMESGGG LIRPIDFMEC KYEGLVGGGG GGGGGNRGHD  240
FMGSNSNNNN STTNGSEQFG IMGGIGGYNG NFNSPFGVFN TTNDIHHHDG SLGISFMDQR  300
MLLPYDGNNH NHHHHHHHHQ NGMDDVKPNP KLLSLEWQDQ GCGGGTTTTT TTTTNTSSDH  360
NGGGKDSPYG YHMNGGGATL GSWTGLMGGF QSPTTNSLV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLK0226902e-51LK022690.1 Fagus sylvatica partial dag gene for dof zinc finger protein, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678773.11e-140PREDICTED: dof zinc finger protein DOF5.6
TrEMBLA0A0K9S1W20.0A0A0K9S1W2_SPIOL; Uncharacterized protein
STRINGVIT_17s0000g08290.t011e-81(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.15e-41Dof family protein