PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof019038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family LBD
Protein Properties Length: 147aa    MW: 15028.6 Da    PI: 6.5349
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-7646PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260301.5e-092425797
     DUF260 57 amsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
               +++sl+yeA  r+ +Pv+Gavg++ ++++q +q ++e++l+
  Sof019038  2 VFQSLLYEAAGRTINPVSGAVGLLGAGSWQPCQQAVETVLR 42
               689********************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031953.3E-5239IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
XVFQSLLYEA AGRTINPVSG AVGLLGAGSW QPCQQAVETV LRGGAIGPLP EFDVGRDTFA  60
LAARRAVGCS TFSTAKRAPT TTRTNVGAPP EPSCDLGLWL SPGSPPAPGE RRRPGTPSMT  120
SEESVTTATT SGGGGGGREP ELLNLFV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.173420.0inflorescence| meristem| seed
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460949.13e-82hypothetical protein SORBIDRAFT_02g038030
TrEMBLC5XD463e-82C5XD46_SORBI; Putative uncharacterized protein Sb02g038030
STRINGSb02g038030.19e-82(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49940.12e-20LOB domain-containing protein 38