PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof017936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family LBD
Protein Properties Length: 166aa    MW: 18152.5 Da    PI: 10.9967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17347898PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260101.67.1e-3229101173
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPv 73 
                +CaaCk+lrrk +++Cv+apyfp e+pkkfanvhk+FGasnv+kllk+l +++reda+ssl+y+Aear+ dP 
  Sof017936  29 PCAACKFLRRKVPPGCVFAPYFPPEEPKKFANVHKVFGASNVTKLLKELLPHQREDAVSSLAYQAEARVMDPG 101
                7***********************************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.71228130IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3029100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MASPSSTSNN SALSPVAASG TTTPGAGAPC AACKFLRRKV PPGCVFAPYF PPEEPKKFAN  60
VHKVFGASNV TKLLKELLPH QREDAVSSLA YQAEARVMDP GLRLRRRHLR ASKARDNRLQ  120
KEADPRPRRA SSITPAETID DVIHNRASRS KCRPKAFHGI EQNQPX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.50580.0crown| inflorescence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455115.16e-61hypothetical protein SORBIDRAFT_03g004590
SwissprotQ9FML45e-43LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLC5XNG86e-61C5XNG8_SORBI; Putative uncharacterized protein Sb03g004590
STRINGSb03g004590.12e-60(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.46e-40LBD family protein