PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof013248
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family LBD
Protein Properties Length: 220aa    MW: 22769.3 Da    PI: 8.8803
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-46070PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.7e-44291281100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l++el+++++e
  Sof013248  29 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQKELDAAHAE 128
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3928129IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-4429126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MASPSSTSNN SALSPVAASG TTTPGAGAPC AACKFLRRKC LPGCVFAPYF PPEEPQKFAN  60
VHKVFGASNV TKLLNELLPH QREDAVSSLA YEAEARVKDP VYGCVGAISV LQRQVHRLQK  120
ELDAAHAELL RYACGDVAAG IPTALPVVSA APRLSTAMTT TSPGQFAAAA ATAHAAAGMY  180
GSSRRLRVLD GVAAPAPXPX AGGCYFMRNH SNVISIPPGX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.50581e-163crown| inflorescence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455115.11e-129hypothetical protein SORBIDRAFT_03g004590
SwissprotQ9FML41e-69LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0H4NWD71e-130A0A0H4NWD7_9POAL; Ramosa 2 protein (Fragment)
TrEMBLA0A0H4NSZ21e-130A0A0H4NSZ2_9POAL; Ramosa 2 protein (Fragment)
TrEMBLA0A0H4NXQ51e-130A0A0H4NXQ5_9POAL; Ramosa 2 protein (Fragment)
TrEMBLA0A0H4NWE71e-130A0A0H4NWE7_9POAL; Ramosa 2 protein (Fragment)
TrEMBLA0A0H4NXQ91e-130A0A0H4NXQ9_9POAL; Ramosa 2 protein (Fragment)
TrEMBLA0A0H4NTW21e-130A0A0H4NTW2_9POAL; Ramosa 2 protein (Fragment)
STRINGSb03g004590.11e-129(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-66LBD family protein