PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof012061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family LBD
Protein Properties Length: 232aa    MW: 24912.8 Da    PI: 9.8606
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17350423PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.4e-4399197199
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ql+++la++k 
  Sof012061  99 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQDLARAKY 197
                7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.72998199IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4399195IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
XHASAFAPAP PDCALSPSEP HSRRRLRQVA RVPRSSSGPG RCSPTLVARP VFFGLFAGDE  60
HHQGRRMASS VPAPSGSVIT VASSSSSAAA AAVCGTGSPC AACKFLRRKC QPDCVFAPYF  120
PPDNPQKFVH VHRVFGASNV TKLLNELHPF QREDAVNSLA YEADMRLRDP VYGCVGVISI  180
LQHNLRQLQQ DLARAKYELS QYQAASGSFL RNXPPTGPQA MARVIGNAMP NG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.158140.0leaf| meristem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105838.16e-98LOB domain-containing protein 6
RefseqXP_008673454.17e-98PREDICTED: LOB domain-containing protein 6 isoform X2
RefseqXP_008673455.17e-98PREDICTED: LOB domain-containing protein 6 isoform X3
RefseqXP_008673456.16e-98PREDICTED: LOB domain-containing protein 6 isoform X1
SwissprotQ32SG31e-100LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A096RXF05e-96A0A096RXF0_MAIZE; LOB domain-containing protein 6
TrEMBLK3XL261e-95K3XL26_SETIT; Uncharacterized protein
STRINGSb03g042310.14e-98(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-58LBD family protein