PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof010477
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family LBD
Protein Properties Length: 251aa    MW: 27600.3 Da    PI: 11.5247
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-88887PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.22.9e-43106204199
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ql+++la++k 
  Sof010477 106 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQDLARAKY 204
                7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.729105206IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-43106202IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
XKAPASKGLF FFLCPRPPRL RALSLRASSR RRLRQVARVP RSSSGPGRCS PTLVARPVFF  60
GLFAGDEHHQ GRRMASSVPA PSGSVITVAS SSSSAAAAAV CGTGSPCAAC KFLRRKCQPD  120
CVFAPYFPPD NPQKFVHVHR VFGASNVTKL LNELHPFQRE DAVNSLAYEA DMRLRDPVYG  180
CVGVISILQH NLRQLQQDLA RAKYELSKYQ AASGSFLRKP RRPGRRRWPE FIGNAKPNGA  240
HNLLTLDTRG X
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.158140.0leaf| meristem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105838.14e-96LOB domain-containing protein 6
RefseqXP_004970852.14e-96PREDICTED: LOB domain-containing protein 6
RefseqXP_008673454.15e-96PREDICTED: LOB domain-containing protein 6 isoform X2
RefseqXP_008673455.15e-96PREDICTED: LOB domain-containing protein 6 isoform X3
RefseqXP_008673456.14e-96PREDICTED: LOB domain-containing protein 6 isoform X1
SwissprotQ32SG34e-98LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A096RXF02e-96A0A096RXF0_MAIZE; LOB domain-containing protein 6
TrEMBLK3XL264e-96K3XL26_SETIT; Uncharacterized protein
STRINGSb03g042310.15e-97(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-58LBD family protein