PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof008282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family NF-YB
Protein Properties Length: 294aa    MW: 33409.9 Da    PI: 8.8685
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-63008PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB72.95e-231193385
      NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
               ++d  lP + + +i+k++lP + ++++da++++ ec +efi +++se+++ c re++kti+++ +l al++lGf++y+e++ +
  Sof008282 11 KEDVSLPKSTMFKIIKEMLPPDVRVARDAQDLLVECCVEFINLLSSESNEVCSREEKKTIAPEHVLKALSDLGFKEYIEEVYA 93
               67999*************************************************************************98754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.4E-378139IPR009072Histone-fold
SuperFamilySSF471131.49E-3412140IPR009072Histone-fold
PfamPF008086.6E-201579IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDPMDIVGKS KEDVSLPKST MFKIIKEMLP PDVRVARDAQ DLLVECCVEF INLLSSESNE  60
VCSREEKKTI APEHVLKALS DLGFKEYIEE VYAAYEQHKL DTLDSPKASK FTGIEMTEEE  120
AVAEQQRMFA EARARMNNGA PKPKEPEQEP PQQPQAQPQL QLHTQQQQPV QSQLAVAFAN  180
TAFXSNLNCS CTLSHNRSPK CRCTLSRSSP HKCRSIRSCS NPHKCRSTRS LRNPKCRSTL  240
SRSSPHKCSC IHQPNKLPNP NLRYICNHRS PHKRSCNPKC QVSCRHRRKA DLAW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B8e-321213312133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.54580.0callus| crown| inflorescence| leaf| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973302.11e-104PREDICTED: protein Dr1 homolog
SwissprotP495927e-79NC2B_ARATH; Protein Dr1 homolog
TrEMBLK3YIU01e-104K3YIU0_SETIT; Uncharacterized protein
STRINGSi014159m1e-103(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.45e-80nuclear factor Y, subunit B13