PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof005226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family NF-YB
Protein Properties Length: 166aa    MW: 17992 Da    PI: 6.1184
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-114243PU_refplantGDBView CDS
gnl|UG|Sof#S17422316PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.34.6e-5820115297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+yveplk+yl+kyre+eg++
  Sof005226  20 REQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYVEPLKIYLQKYREMEGDS 115
                89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-5418125IPR009072Histone-fold
SuperFamilySSF471131.13E-4022118IPR009072Histone-fold
PfamPF008081.3E-282589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.6E-235371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.6E-237290No hitNo description
PRINTSPR006156.6E-2391109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MADDGGSHEG GGSGGGGGYR EQDRFLPIAN ISRIMKKAVP ANGKIAKDAK ETLQECVSEF  60
ISFVTSEASD KCQKEKRKTI NGDDLLWAMA TLGFEEYVEP LKIYLQKYRE MEGDSKLSTK  120
AGEGSVKKDA ISSHGGTSSS SNQLVQHGVY NQGMGYMQPQ YHNGDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-5018110193NF-YB
4awl_B4e-5018110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-5018110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.227290.0inflorescence| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970483.11e-105PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotP252094e-91NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLK3XMN61e-105K3XMN6_SETIT; Uncharacterized protein
STRINGSi003159m1e-105(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-69nuclear factor Y, subunit B10