PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof004604
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family LBD
Protein Properties Length: 203aa    MW: 20921.9 Da    PI: 8.3769
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-580133726PU_refplantGDBView CDS
gnl|UG|Sof#S17420472PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.94.1e-44371361100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++Cv+apyfp  +p+kfanvhk+FGasnv+kll+++p ++r da+sslvyeA+ar+rdPvyG+vg i++lqqq+e l+a+lal+++e
  Sof004604  37 PCAACKLLRRRCAAGCVFAPYFPPGEPHKFANVHKVFGASNVSKLLQEIPVQHRGDAVSSLVYEANARVRDPVYGCVGAISSLQQQVEALQAQLALAQAE 136
                7***********************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6936137IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4337134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MRDAVVVMAV PGAGAGAGGG KAGAGGGGGG GASSAAPCAA CKLLRRRCAA GCVFAPYFPP  60
GEPHKFANVH KVFGASNVSK LLQEIPVQHR GDAVSSLVYE ANARVRDPVY GCVGAISSLQ  120
QQVEALQAQL ALAQAEMVRL KMSNDYILHR LKAARTGGGS SYTGSPSSMS SPKTAEPEVH  180
CKATPELLDM VVDQPSMDDA HFW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11826GGKAGAGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.170210.0inflorescence| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466719.17e-95hypothetical protein SORBIDRAFT_01g012810
SwissprotQ8LBW31e-58LBD12_ARATH; LOB domain-containing protein 12
TrEMBLC5WQF38e-95C5WQF3_SORBI; Putative uncharacterized protein Sb01g012810
STRINGSb01g012810.12e-94(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-37LOB domain-containing protein 4