PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof004312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family WOX
Protein Properties Length: 215aa    MW: 24005 Da    PI: 7.7624
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-83017PU_refplantGDBView CDS
gnl|UG|Sof#S17306529PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-1993153257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                r+R+++t+ ql++Le+ F + n +ps+++++e++++l    +++e++V++W qNrRa+ k+
  Sof004312  93 RQRWQPTPMQLQILENIFDQgNGTPSKQKIKEITAELshhgQISETNVYNWVQNRRARSKR 153
                89*****************99**************************************97 PP

2Wus_type_Homeobox97.41.2e-3192155265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RW Ptp Q++iLe+++++G  tP+k++i++itaeL+++G+i+++NV++W QNr+aR+++kq
          Sof004312  92 ARQRWQPTPMQLQILENIFDQGNGTPSKQKIKEITAELSHHGQISETNVYNWVQNRRARSKRKQ 155
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-1588158IPR009057Homeodomain-like
PROSITE profilePS5007113.66989154IPR001356Homeobox domain
SMARTSM003892.8E-1291158IPR001356Homeobox domain
SuperFamilySSF466891.11E-1692156IPR009057Homeodomain-like
CDDcd000863.97E-1293155No hitNo description
PfamPF000465.6E-1793153IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MEWGDRAKAS AAAVAADERA GGGEVLGGYV KVMTDEQMEV LRKQISIYAT ICEQLVDMHR  60
TLTEHQDTIA GMRFSNLYSD PLIIPGGHKI TARQRWQPTP MQLQILENIF DQGNGTPSKQ  120
KIKEITAELS HHGQISETNV YNWVQNRRAR SKRKQAVSLP NTSNAESQAE VEEESFHRQE  180
AQSPDRFTPK INKGYWVGSP VAGQGISKGN ALQLF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.229310.0crown| inflorescence
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456540.11e-106WUSCHEL-related homeobox 8
SwissprotQ5QMM33e-85WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLC5XN901e-105C5XN90_SORBI; Uncharacterized protein
STRINGSb03g038080.11e-105(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.15e-65WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]