PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof004120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family TCP
Protein Properties Length: 222aa    MW: 23938.4 Da    PI: 11.4461
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-72544PU_refplantGDBView CDS
gnl|UG|Sof#S17448212PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.55.9e-3963140279
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+pai ++tgt++++as+  +++ s
  Sof004120  63 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEPAIVAATGTGTIPASALASVAPS 140
                789******************************************************************766222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.1E-3168145IPR005333Transcription factor, TCP
PROSITE profilePS5136928.03969123IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
XTATSTAQQL DPKDYQQQQP AQHHLQIQIH QPPQQDGGGG GKEQQQQLQV VAQPGERRQQ  60
PLAPKRSSNK DRHTKVDGRG RRIRMPALCA ARIFQLTREL GHKSDGETVQ WLLQQAEPAI  120
VAATGTGTIP ASALASVAPS LPSPTSGLAR PHHHHHPHHM WAPSAASAGF YSPSFLKFAA  180
ASTGDAAGIG GIMQRMGIPG ASSCRRGRRW GTLRSGGHIW FX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.175790.0inflorescence| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456872.12e-83transcription factor TCP20
TrEMBLC5XGD65e-82C5XGD6_SORBI; Uncharacterized protein
STRINGSb03g044320.19e-83(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.18e-41TCP family protein