PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 89227
Common NameSELMODRAFT_104521, SELMODRAFT_89227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family TCP
Protein Properties Length: 86aa    MW: 9694.16 Da    PI: 10.9313
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
89227genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1081.5e-331173264
    TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltg 64
            g+kdrhsk+ T++g+RdRRvRls+++a++f+d+qd+LG+d++sk++eWL+++ak ai+el +
  89227 11 SGGKDRHSKVFTAKGPRDRRVRLSVSTAIQFYDVQDRLGYDQPSKAVEWLMKKAKNAIDELSQ 73
           689*********************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.1E-331273IPR005333Transcription factor, TCP
PROSITE profilePS5136932.8551371IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MNISARTLRP SGGKDRHSKV FTAKGPRDRR VRLSVSTAIQ FYDVQDRLGY DQPSKAVEWL  60
MKKAKNAIDE LSQIPLPGID RLTLPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-251871154Putative transcription factor PCF6
5zkt_B2e-251871154Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00006PBMTransfer from 493022Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024529105.12e-53uncharacterized protein LOC112345826
RefseqXP_024529106.12e-53uncharacterized protein LOC112345826
RefseqXP_024536722.11e-53AF4/FMR2 family member 4-like
RefseqXP_024536723.11e-53AF4/FMR2 family member 4-like
SwissprotQ93V434e-32TCP2_ARATH; Transcription factor TCP2
TrEMBLD8RBQ33e-56D8RBQ3_SELML; Uncharacterized protein (Fragment)
STRINGEFJ228105e-57(Selaginella moellendorffii)
STRINGEFJ308305e-57(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.22e-34TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  3. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]