PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 85122
Common NameSELMODRAFT_85122
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Trihelix
Protein Properties Length: 324aa    MW: 34943.9 Da    PI: 9.7516
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
85122genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix941.4e-2986170187
  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
               rW k+e+ aLi++r++m++++r++ lk+plW+evs+k++e g++rs+k+Ckek+en+ k+ykk k+g+ +r++++s  +++f ++ea
     85122  86 RWLKEETSALIKIRNDMDRSFRDSPLKGPLWAEVSRKLAELGYQRSSKKCKEKFENVYKYYKKSKDGRAGRQDGKS--YRFFADMEA 170
               8*********************************************************************866665..*******85 PP

2trihelix108.44.5e-34231316187
  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
               rW+k evlaLi++r+++e +++++  k+plWee+s+ m+  g++rs+k+Ckekwen+nk+++k+k+++kkr +e+s+tcpyf+ql+a
     85122 231 RWPKPEVLALIKLRSSIEGKFQETGPKGPLWEEISSGMSCMGYSRSAKRCKEKWENINKYFRKTKDSSKKR-PENSKTCPYFHQLDA 316
               8*********************************************************************8.9999*********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002783145IPR001005SANT/Myb domain
PfamPF138371.5E-2085171No hitNo description
Gene3DG3DSA:1.10.10.606.3E-485144IPR009057Homeodomain-like
PROSITE profilePS500907.18986143IPR017877Myb-like domain
CDDcd122032.27E-2286150No hitNo description
SMARTSM007170.032228290IPR001005SANT/Myb domain
CDDcd122035.85E-30230295No hitNo description
PfamPF138371.8E-22230317No hitNo description
PROSITE profilePS500907.027231288IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MQQLGLARSS GDQEPDPGGV AGGDGNSVAP PPPPPPAAPP KINVSQPGGA APPGPPSLAQ  60
QDHQQKFDEE GGVDDGDRGG GGGGQRWLKE ETSALIKIRN DMDRSFRDSP LKGPLWAEVS  120
RKLAELGYQR SSKKCKEKFE NVYKYYKKSK DGRAGRQDGK SYRFFADMEA LFSGGGGGAA  180
GGTAGGGGGS PSSNIDHHHH HHHPDGTAQH ELVAVRGESG QHGGFDPASK RWPKPEVLAL  240
IKLRSSIEGK FQETGPKGPL WEEISSGMSC MGYSRSAKRC KEKWENINKY FRKTKDSSKK  300
RPENSKTCPY FHQLDALYRK GVLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024526339.13e-84trihelix transcription factor GTL1
TrEMBLD8R3320.0D8R332_SELML; Uncharacterized protein (Fragment)
STRINGEFJ328750.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-44Trihelix family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]