PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 84991
Common NameSELMODRAFT_449949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRAS
Protein Properties Length: 349aa    MW: 39209.4 Da    PI: 6.2575
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
84991genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS320.92.7e-982034633373
   GRAS  33 pdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasR 135
            p+  +p++R+ +++ +AL++r+++  ++++    +     ++s++ ++a+++f++ +P+lkf+h+taNqaIle++ g++++Hi+D+di qG+QWp+L+qaL++ 
  84991  20 PHLsSPIERVSTHICKALSERITK--TSIF---DA-----TTSDDLAFARRAFYQHFPFLKFAHFTANQAILESLRGCSKLHIVDLDIDQGMQWPSLIQALSQ- 112
            333379******************..2222...22.....2368999******************************************************98. PP

   GRAS 136 pegppslRiTgvgspesgskeeleetgerLakfAeelgv.pfefnvlvakrledleleeLrvkp....gEalaVnlvlqlhrlldesvsleserdevLklvksl 234
             e++pslRiTgvgs    s  el++tg+rL++fA+++g  +++++++  ++ ++l+++++++      +  laVn+++ lhrll ++ +le     +L +++  
  84991 113 IENAPSLRITGVGS----SLAELQSTGRRLTEFATSIGYhKLDYHPVRLDSPDQLDPSAFSLGDdddqDLGLAVNCSMFLHRLLGNHPALER----TLCMIRAW 208
            6889**********....9*******************747******999**********998865444469************88888888....******** PP

   GRAS 235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
            +P++v+v+e ea+hn++sF++rf+eal++ysa+fd+le+ l+r++ +ri +E ++++ ei++++acega+r+ rh + e+Wr+ ++ +GFk v ls++   qa+
  84991 209 NPRIVTVSEMEANHNTPSFVDRFVEALHFYSAVFDCLESALARTDPDRIYIEGAMFAGEIRSILACEGADRIVRHARSESWRDFMRWSGFKDVGLSDHSLYQAH 312
            ******************************************************************************************************** PP

   GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
              l  ++ + yr+  e+++l+lgW+d p+vs+S W
  84991 313 VFLTLYS-QAYRLTREEQALILGWHDTPVVSISTW 346
            *******.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.021328IPR005202Transcription factor GRAS
PfamPF035149.2E-9620346IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MATSKLILDH LAASSRDHPP HLSSPIERVS THICKALSER ITKTSIFDAT TSDDLAFARR  60
AFYQHFPFLK FAHFTANQAI LESLRGCSKL HIVDLDIDQG MQWPSLIQAL SQIENAPSLR  120
ITGVGSSLAE LQSTGRRLTE FATSIGYHKL DYHPVRLDSP DQLDPSAFSL GDDDDQDLGL  180
AVNCSMFLHR LLGNHPALER TLCMIRAWNP RIVTVSEMEA NHNTPSFVDR FVEALHFYSA  240
VFDCLESALA RTDPDRIYIE GAMFAGEIRS ILACEGADRI VRHARSESWR DFMRWSGFKD  300
VGLSDHSLYQ AHVFLTLYSQ AYRLTREEQA LILGWHDTPV VSISTWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-561334627374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2627448e-09Selaginella moellendorffii putative DELLA protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002965561.10.0GRAS family protein
TrEMBLD8R3Q50.0D8R3Q5_SELML; GRAS family protein
STRINGEFJ329810.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.16e-69RGA-like 1
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]