PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 84608
Common NameSELMODRAFT_84608, SELMODRAFT_89380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 89aa    MW: 10298.9 Da    PI: 9.9125
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
84608genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.7e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+lv++++++G  +W+t+++  g+ R++k+c++rw +yl
            84608 14 KGLWSPEEDEKLVRYITKYGHSCWSTVPEQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-28664IPR009057Homeodomain-like
PROSITE profilePS5129424.441965IPR017930Myb domain
SMARTSM007174.7E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
SuperFamilySSF466893.13E-221688IPR009057Homeodomain-like
CDDcd001671.38E-101761No hitNo description
PROSITE profilePS500904.0196288IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.4E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGRHSCCQKQ KLKKGLWSPE EDEKLVRYIT KYGHSCWSTV PEQAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TSHEEKLIID LHAALGNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-161288580B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002965582.15e-61hypothetical protein SELMODRAFT_84608
RefseqXP_002968061.15e-61hypothetical protein SELMODRAFT_89380
SwissprotQ8LPH65e-50MYB86_ARATH; Transcription factor MYB86
TrEMBLD8R3U96e-61D8R3U9_SELML; Putative uncharacterized protein
STRINGEFJ303152e-60(Selaginella moellendorffii)
STRINGEFJ330022e-60(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-54myb domain protein 55
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]