PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 81360
Common NameSELMODRAFT_81360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB
Protein Properties Length: 266aa    MW: 30986.1 Da    PI: 6.0824
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
81360genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.8e-0969113246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+W++ Ed++l+   k++G  +W+++a+++g+ Rt+ qc  r+q 
            81360  69 GPWSKAEDLQLLGIAKEFGFAQWESVAEKLGTYRTPAQCLIRYQR 113
                      89**************************************99996 PP

2Myb_DNA-binding32.42.2e-10123166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       W+ e+de+l+ av + G ++W  +a+++  gRt+ q  +rw  +
            81360 123 EWSREDDEQLKLAVDMCGEKDWQNVAACLE-GRTGQQAMHRWKEV 166
                      6*****************************.***********865 PP

3Myb_DNA-binding60.92.7e-19172218148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgrW+ eEd++l++av   G+++Wk++a++++ gR++ qc++rw+++l
            81360 172 RGRWSLEEDKRLKCAVMVCGPHQWKSVAAHVP-GRSETQCRERWRNVL 218
                      8*******************************.************986 PP

4Myb_DNA-binding45.41.8e-14227266444
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      W++eEde+l +av+++G++ W+++a+ m   Rt++qc  rw
            81360 227 WSPEEDEKLEEAVEKFGMHKWSSVAEVMS-PRTDNQCWRRW 266
                      *****************************.9******9999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071736864IPR001005SANT/Myb domain
PROSITE profilePS500905.5991362IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.7E-83774IPR009057Homeodomain-like
SuperFamilySSF466897.99E-1546112IPR009057Homeodomain-like
PROSITE profilePS5129412.76963119IPR017930Myb domain
SMARTSM007175.1E-867117IPR001005SANT/Myb domain
PfamPF139211.0E-1071132No hitNo description
Gene3DG3DSA:1.10.10.601.8E-1075121IPR009057Homeodomain-like
SuperFamilySSF466891.05E-1697169IPR009057Homeodomain-like
PROSITE profilePS500908.293116166IPR017877Myb-like domain
SMARTSM007176.4E-9120169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-12122168IPR009057Homeodomain-like
CDDcd001671.95E-8123167No hitNo description
PROSITE profilePS5129424.676167222IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-19169218IPR009057Homeodomain-like
SMARTSM007172.5E-17171220IPR001005SANT/Myb domain
PfamPF002493.0E-18172218IPR001005SANT/Myb domain
CDDcd001673.03E-12174218No hitNo description
SuperFamilySSF466891.23E-23198266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-15219266IPR009057Homeodomain-like
SMARTSM007173.3E-5223266IPR001005SANT/Myb domain
CDDcd001673.45E-11227266No hitNo description
PROSITE profilePS5129417.671227266IPR017930Myb domain
PfamPF002491.0E-12227266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEAVVLDLKT GVSLEEREKE IDNISDAEVR NLIDVVDWEI VSRGSLPART AKECKARWIN  60
FEDKLINHGP WSKAEDLQLL GIAKEFGFAQ WESVAEKLGT YRTPAQCLIR YQRSLNANLS  120
LREWSREDDE QLKLAVDMCG EKDWQNVAAC LEGRTGQQAM HRWKEVLRGK KRGRWSLEED  180
KRLKCAVMVC GPHQWKSVAA HVPGRSETQC RERWRNVLDP NLSFDMWSPE EDEKLEEAVE  240
KFGMHKWSSV AEVMSPRTDN QCWRRW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C4e-29372662158MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-29372662158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002964349.10.0hypothetical protein SELMODRAFT_81360, partial
TrEMBLD8QYV50.0D8QYV5_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ346820.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-73myb domain protein 4r1
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]