PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 78045
Common NameLHY-like, SELMODRAFT_78045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 337aa    MW: 38038.6 Da    PI: 10.8271
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
78045genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-132670147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
            78045 26 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 70
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-162076IPR009057Homeodomain-like
PROSITE profilePS5129415.4082175IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-62476IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-182473IPR006447Myb domain, plants
SMARTSM007175.3E-112573IPR001005SANT/Myb domain
PfamPF002492.8E-112670IPR001005SANT/Myb domain
CDDcd001672.12E-82871No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MANPALPSDD AVSKKIRKPY TITKSRESWT EQEHDKFLEA LQLFDRDWKK IEAFVGSKTV  60
IQIRSHAQKY FLKVQKNGTG EHVPPPRPKR KSAQPYPQKA AKPGKLPIPN CEFHSVFLCS  120
TAPPQRGTPH PPPPDFAYMV PQCNMFVPGV TASPVSSWVH HGGPQGTIPF YKGGSFNQNN  180
SSTANTWAQD PPAQANPQRG RKTGEKVDRA NGIVTLSAAP AFSEVYKFIG SIFDPGTAGH  240
LKKLREMAPI DRETVLLLMR NLAINLSSPD FDQRVKFADK RFFRSFQRFC FSGLSRDRSC  300
SFQSTKRRKT EWILTTSNKV VMKKQQETWR KVRKKH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002962971.10.0hypothetical protein SELMODRAFT_78045
SwissprotQ8H0W34e-84RVE6_ARATH; Protein REVEILLE 6
TrEMBLD8QVD00.0D8QVD0_SELML; Putative uncharacterized protein LHY-like
STRINGEFJ364340.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.23e-83MYB_related family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]