PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 75102
Common NameSELMODRAFT_75102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family CPP
Protein Properties Length: 156aa    MW: 16710.3 Da    PI: 8.3731
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
75102genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.73e-15138542
    TCR  5 gCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
           +C+CkkskClk+YCeCfa+g++C ++C C +C+N++e+
  75102  1 RCSCKKSKCLKLYCECFASGSYCLDSCACGNCSNRQEH 38
           5*********************************9986 PP

2TCR53.35.4e-1796135140
    TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
            k+k+gCnCkks ClkkYCeCf++++ Cs+ CkC +CkN+ 
  75102  96 KHKRGCNCKKSLCLKKYCECFQSEVGCSDACKCRGCKNTF 135
            589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163433.9481136IPR005172CRC domain
PfamPF036381.3E-11135IPR005172CRC domain
SMARTSM011143.7E-10138IPR033467Tesmin/TSO1-like CXC domain
SMARTSM011142.3E-1796137IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.2E-1398134IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
RCSCKKSKCL KLYCECFASG SYCLDSCACG NCSNRQEHED VVSETRQLIQ SRNPLAFAPR  60
VISPAEVVRV CQAFVSSNSL IFVSPAAAAI PAATSKHKRG CNCKKSLCLK KYCECFQSEV  120
GCSDACKCRG CKNTFGAKQG DDFFVVCIAT VNAGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002960061.11e-108hypothetical protein SELMODRAFT_75102, partial
SwissprotQ8L5483e-48TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLD8QPD31e-108D8QPD3_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ376001e-108(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.13e-37Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]